CD53 Protein, Cynomolgus (HEK293, Fc)

CD53 protein is an important member of the tetraspanin family and plays an important role in immune response, cell adhesion and signal transduction. Its research enhances understanding of cell membrane organization and function, with potential applications in immunology and cancer research. CD53 Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived CD53 protein, expressed by HEK293 , with N-mFc labeled tag.

The CD53 Protein is an integral member of the tetraspanin (TM4SF) family, underscoring its essential role in cellular processes, including immune responses, cell adhesion, and signal transduction. As part of this family, CD53 likely shares conserved structural and functional features with related proteins, emphasizing its involvement in the formation of tetraspanin-enriched microdomains and interactions with other cellular molecules. The classification within the tetraspanin family underscores its specific designation within the broader context of membrane proteins, providing insights into its unique contributions to cell membrane organization and function. The study of CD53 contributes to our understanding of its role in diverse physiological processes, offering potential applications in immunology, cancer research, and a deeper comprehension of its broader impact on cellular functions. Further exploration of CD53's role holds promise for enhancing our knowledge of its contributions to both normal physiology and pathological conditions.

Cynomolgus

HEK293

N-mFc

G7NW46 (E107-N181)

102127943  [NCBI]

Partial

EQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDPNVEGCYAKARLWFHSN

Approximately 44 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.