CD59 Protein, Human (P.pastoris, His)

The CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) and binds to assembled C8 and/or C9 complement, preventing the incorporation of multiple C9 copies that are critical for permeability pore formation. Its species-specific inhibitory effects extend to T cell activation, complexing with protein tyrosine kinases for signal transduction. CD59 Protein, Human (P.pastoris, His) is the recombinant human-derived CD59 protein, expressed by P. pastoris , with N-His labeled tag. The total length of CD59 Protein, Human (P.pastoris, His) is 77 a.a., with molecular weight of ~11.0 kDa.

CD59 protein is a potent inhibitor of the complement membrane attack complex (MAC) action. It functions by binding to the assembling MAC's C8 and/or C9 complements, thereby impeding the incorporation of multiple copies of C9 necessary for the formation of the osmolytic pore. Notably, this inhibitor exhibits species-specificity. Additionally, CD59 is involved in T-cell activation complexed with a protein tyrosine kinase for signal transduction. It is worth noting that while the soluble form of CD59 from urine retains its specific complement binding activity, it demonstrates a significantly reduced ability to inhibit MAC assembly on cell membranes.

Human

P. pastoris

N-His

P13987 (L26-N102)

966  [NCBI]

LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN

Approximately 11.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.