CD7 Protein, Rat (HEK293, Fc)

The CD7 Protein is a member of the immunoglobulin superfamily expressed in thymocytes and mature T cells. CD7 Protein can activate the PI3K signaling pathway involved in the activation of T and NK cells. CD7 Protein is a key factor in the treatment of T-cell acute lymphoblastic leukemia (T-ALL) and T-lymphoma. CD7 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD7 protein, expressed by HEK293 , with C-hFc labeled tag.

CD7 Protein is a transmembrane protein of the immunoglobulin superfamily found in thymocytes and mature T cells. It plays an important role in T cell interactions and T cell/B cell interactions during early lymphocyte development. CD7 can activate PI3K signaling pathway and participate in the activation of T and NK cells. CD7 is widely distributed in tumors and is considered to be a key factor in the treatment of T-cell acute lymphoblastic leukemia (T-ALL) and T-lymphoma^[1][2][3].

Measured by its binding ability in a functional ELISA. Immobilized Rat CD7, at 0.5μg/mL (100μL/well) can bind Anti-CD7 antibody. The ED₅₀ for this effect is 2.645μg /mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Rat CD7, at 0.5 μg/mL (100μL/well) can bind Anti-CD7 antibody. The ED₅₀ for this effect is 2.645μg /mL.

Rat

HEK293

C-hFc

B2RZ54 (Q23-P149)

303747  [NCBI]

Partial

QEVHQSPRVVIASEGESINITCSTRGDLEGLIMKRIWPQASNVIYFEDELEPTVDSAFSGRINFSGSQKNLTIIMSLLQEADTGAYTCEAVRKVSVHGLFTTVVVKEKLSHEAYRSQEPLQTSVSLP

Approximately 45-60 kDa due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.