1. Recombinant Proteins
  2. CAR-T Related Proteins CD Antigens
  3. CD7 NK Cell CD Proteins Macrophage CD Proteins
  4. CD7 Protein, Rat (HEK293, Fc)

The CD7 Protein is a member of the immunoglobulin superfamily expressed in thymocytes and mature T cells. CD7 Protein can activate the PI3K signaling pathway involved in the activation of T and NK cells. CD7 Protein is a key factor in the treatment of T-cell acute lymphoblastic leukemia (T-ALL) and T-lymphoma. CD7 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD7 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CD7 Protein is a member of the immunoglobulin superfamily expressed in thymocytes and mature T cells. CD7 Protein can activate the PI3K signaling pathway involved in the activation of T and NK cells. CD7 Protein is a key factor in the treatment of T-cell acute lymphoblastic leukemia (T-ALL) and T-lymphoma. CD7 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD7 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

CD7 Protein is a transmembrane protein of the immunoglobulin superfamily found in thymocytes and mature T cells. It plays an important role in T cell interactions and T cell/B cell interactions during early lymphocyte development. CD7 can activate PI3K signaling pathway and participate in the activation of T and NK cells. CD7 is widely distributed in tumors and is considered to be a key factor in the treatment of T-cell acute lymphoblastic leukemia (T-ALL) and T-lymphoma[1][2][3].

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Rat CD7, at 0.5μg/mL (100μL/well) can bind Anti-CD7 antibody. The ED50 for this effect is 2.645μg /mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Rat CD7, at 0.5 μg/mL (100μL/well) can bind Anti-CD7 antibody. The ED50 for this effect is 2.645μg /mL.
Species

Rat

Source

HEK293

Tag

C-hFc

Accession

B2RZ54 (Q23-P149)

Gene ID
Molecular Construction
N-term
CD7 (Q23-P149)
Accession # B2RZ54
hFc
C-term
Protein Length

Partial

Synonyms
CD7; LEU-9; T-cell antigen CD7
AA Sequence

QEVHQSPRVVIASEGESINITCSTRGDLEGLIMKRIWPQASNVIYFEDELEPTVDSAFSGRINFSGSQKNLTIIMSLLQEADTGAYTCEAVRKVSVHGLFTTVVVKEKLSHEAYRSQEPLQTSVSLP

Molecular Weight

Approximately 45-60 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CD7 Protein, Rat (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD7 Protein, Rat (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD7 Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P74273
Quantity:
MCE Japan Authorized Agent: