CD81 Protein, Rat (HEK293, Fc)

CD81, a versatile protein, participates in complement-opsonized particle ingestion, inhibits osteoclast formation, and regulates compartmentalized enzymatic activities. In T cells, CD81 controls intracellular dNTP levels by localizing and degrading SAMHD1. Moreover, it influences cell adhesion and motility, notably in macrophages. CD81 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD81 protein, expressed by HEK293 , with N-mFc labeled tag.

CD81 is a protein involved in various cellular processes. It plays a role in complement-opsonized particle ingestion, prevents the formation of osteoclasts responsible for bone resorption, and regulates enzymatic activities within cellular compartments. In T cells, CD81 helps control intracellular dNTP levels by localizing and degrading the protein SAMHD1. It is also involved in cell adhesion and motility, particularly in macrophages.

Rat

HEK293

N-mFc

Q62745/NP_037219.1 (K116-K201)

25621  [NCBI]

Partial

KDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNTLTTLTTAVLRNSLCPSSSNSFTQLLKEDCHQKIDELFSGK

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.