1. Recombinant Proteins
  2. CD Antigens
  3. T Cell CD Proteins B Cell CD Proteins Dendritic Cell CD Proteins
  4. CD83
  5. CD83 Protein, Cynomolgus (HEK293, Fc)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Cynomolgus (HEK293, Fc) is the recombinant cynomolgus-derived CD83 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

CD83 Protein is suggested to play a significant role, potentially contributing to antigen presentation or mediating cellular interactions that ensue following lymphocyte activation. The specific mechanisms through which CD83 influences these processes, particularly in the context of immune responses, remain to be fully elucidated. As a monomer, CD83 may participate in distinct molecular events that impact antigen presentation and cellular interactions, highlighting its potential as a key regulatory element in modulating immune responses. In-depth investigations are needed to unravel the intricacies of CD83's function and its implications in the orchestration of immune processes.

Species

Cynomolgus

Source

HEK293

Tag

C-hFc

Accession

F6WX37 (T20-A143)

Gene ID
Molecular Construction
N-term
CD83 (T20-A143)
Accession # F6WX37
hFc
C-term
Protein Length

Partial

Synonyms
B-cell activation protein; CD83 antigen; hCD83; CD83; BL11
AA Sequence

TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSLDAPSERPYSLKIRNTTSCNSGAYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRA

Predicted Molecular Mass
41 kDa
분자량

Approximately 45-55 kDa & 34 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

CD83 Protein, Cynomolgus (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

CD83 Protein, Cynomolgus (HEK293, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
CD83 Protein, Cynomolgus (HEK293, Fc)
Cat. No.:
HY-P76245
수량:
MCE Japan Authorized Agent: