CD83 Protein, Mouse (113a.a, HEK293, Fc)

CD83 protein may be a key player in antigen presentation and cellular interactions during lymphocyte activation, highlighting its importance in immune processes. It potentially orchestrates antigen presentation and acts as a monomer. Investigating CD83's mechanisms in antigen presentation and lymphocyte activation could provide insights into its crucial role in shaping immune responses and cellular interactions within the immune system. CD83 Protein, Mouse (113a.a, HEK293, Fc) is the recombinant mouse-derived CD83 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD83 Protein, Mouse (113a.a, HEK293, Fc) is 113 a.a., with molecular weight of 55-65 kDa.

The CD83 protein emerges as a potential key player in antigen presentation or the subsequent cellular interactions that occur following lymphocyte activation, underscoring its significance in immune processes. Its involvement suggests a potential role in orchestrating the presentation of antigens, a crucial step in immune recognition and response. Structurally, CD83 functions as a monomer, indicating its singular molecular form in executing its biological activities. Further exploration into the specific mechanisms by which CD83 participates in antigen presentation and lymphocyte activation could provide valuable insights into its pivotal role in shaping immune responses and cellular interactions within the immune system.

Mouse

HEK293

C-hFc

O88324 (M22-A134)

12522  [NCBI]

MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYRA

55-65 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.