CD83 Protein, Mouse (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

CD83 protein may be a key player in antigen presentation and cellular interactions during lymphocyte activation, highlighting its importance in immune processes. It potentially orchestrates antigen presentation and acts as a monomer. Investigating CD83's mechanisms in antigen presentation and lymphocyte activation could provide insights into its crucial role in shaping immune responses and cellular interactions within the immune system. CD83 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD83 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CD83 protein may be a key player in antigen presentation and cellular interactions during lymphocyte activation, highlighting its importance in immune processes. It potentially orchestrates antigen presentation and acts as a monomer. Investigating CD83's mechanisms in antigen presentation and lymphocyte activation could provide insights into its crucial role in shaping immune responses and cellular interactions within the immune system. CD83 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD83 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The CD83 protein emerges as a potential key player in antigen presentation or the subsequent cellular interactions that occur following lymphocyte activation, underscoring its significance in immune processes. Its involvement suggests a potential role in orchestrating the presentation of antigens, a crucial step in immune recognition and response. Structurally, CD83 functions as a monomer, indicating its singular molecular form in executing its biological activities. Further exploration into the specific mechanisms by which CD83 participates in antigen presentation and lymphocyte activation could provide valuable insights into its pivotal role in shaping immune responses and cellular interactions within the immune system.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD83 (M22-A134)
      Accession # O88324
    • hFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD83; Cell Surface Protein HB15; CD83 Molecule; CD83 Antigen; HB15; HCD83; BL11; Cell-Surface Glycoprotein; CD83 Antigen (Activated B Lymphocytes, Immunoglobulin Superfamily); B-Cell Activation Protein

  • AA Sequence

    MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYRA

  • Predicted Molecular Mass

    39.5 kDa

  • Molecular Weight

    Approximately 50-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00