CD83 Protein, Mouse (HEK293, Fc)
Based on 1 Customer Validation
CD83 protein may be a key player in antigen presentation and cellular interactions during lymphocyte activation, highlighting its importance in immune processes. It potentially orchestrates antigen presentation and acts as a monomer. Investigating CD83's mechanisms in antigen presentation and lymphocyte activation could provide insights into its crucial role in shaping immune responses and cellular interactions within the immune system. CD83 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD83 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CD83 protein may be a key player in antigen presentation and cellular interactions during lymphocyte activation, highlighting its importance in immune processes. It potentially orchestrates antigen presentation and acts as a monomer. Investigating CD83's mechanisms in antigen presentation and lymphocyte activation could provide insights into its crucial role in shaping immune responses and cellular interactions within the immune system. CD83 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD83 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
The CD83 protein emerges as a potential key player in antigen presentation or the subsequent cellular interactions that occur following lymphocyte activation, underscoring its significance in immune processes. Its involvement suggests a potential role in orchestrating the presentation of antigens, a crucial step in immune recognition and response. Structurally, CD83 functions as a monomer, indicating its singular molecular form in executing its biological activities. Further exploration into the specific mechanisms by which CD83 participates in antigen presentation and lymphocyte activation could provide valuable insights into its pivotal role in shaping immune responses and cellular interactions within the immune system.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
O88324 (M22-A134)
-
Molecular Construction
-
N-term
-
CD83 (M22-A134)
Accession # O88324 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD83; Cell Surface Protein HB15; CD83 Molecule; CD83 Antigen; HB15; HCD83; BL11; Cell-Surface Glycoprotein; CD83 Antigen (Activated B Lymphocytes, Immunoglobulin Superfamily); B-Cell Activation Protein
-
AA Sequence
MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYRA
-
Predicted Molecular Mass
39.5 kDa
-
Molecular Weight
Approximately 50-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)