CD84/SLAMF5 Protein, Rhesus Macaque (HEK293, His)

CD84/SLAMF5 protein is a self-ligand receptor in the SLAM family that regulates the activities of various immune cells through homotypic or heterotypic cell-cell interactions. It fine-tunes its function based on the presence or absence of small cytoplasmic adapter proteins, including SH2D1A/SAP and/or SH2D1B/EAT-2. CD84/SLAMF5 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD84/SLAMF5 protein, expressed by HEK293 , with C-His labeled tag.

The CD84/SLAMF5 protein serves as a self-ligand receptor within the signaling lymphocytic activation molecule (SLAM) family, engaging in homo- or heterotypic cell-cell interactions that modulate the activation and differentiation of diverse immune cells, contributing to the intricate regulation and interconnection of both innate and adaptive immune responses. The protein's activities are finely tuned by the presence or absence of small cytoplasmic adapter proteins, including SH2D1A/SAP and/or SH2D1B/EAT-2. CD84/SLAMF5 can mediate natural killer (NK) cell cytotoxicity, dependent on both SH2D1A and SH2D1B. It enhances proliferative responses of activated T-cells, and SH2D1A/SAP appears not to be required for this process. Homophilic interactions amplify interferon gamma/IFNG secretion in lymphocytes and induce platelet stimulation via a SH2D1A-dependent pathway. The protein may serve as a marker for hematopoietic progenitor cells. Essential for prolonged T-cell:B-cell contact, optimal T follicular helper function, and germinal center formation, CD84/SLAMF5 in germinal centers contributes to maintaining B-cell tolerance and preventing autoimmunity. In mast cells, it negatively regulates high-affinity immunoglobulin epsilon receptor signaling, independently of SH2D1A and SH2D1B but implicating FES and PTPN6/SHP-1. In macrophages, it positively regulates LPS-induced MAPK phosphorylation and NF-kappaB activation, modulating LPS-induced cytokine secretion. Additionally, CD84/SLAMF5 positively regulates macroautophagy in primary dendritic cells through the stabilization of IRF8 and inhibits TRIM21-mediated proteasomal degradation of IRF8. The protein forms homodimers via its extracellular domain and interacts with CD48 molecules from other cells in a head-to-tail dimeric arrangement. It also interacts with SH2 domain-containing proteins, including SH2D1A/SAP and SH2D1B/EAT-2, and tyrosine-protein phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 via its phosphorylated cytoplasmic domain, with the latter interaction blocked by SH2D1A. CD84/SLAMF5 further interacts with INPP5D/SHIP1 through its phosphorylated ITSM domains.

Measured in a cell proliferation assay using PHA stimulated Jurkat cells in the presence of anti-CD3. The ED₅₀ for this effect is 1.389 μg/mL in the presence of anti-CD3 immobilized at 2μg/mL, corresponding to a specific activity is 719.942 units/mg.

• 
  Measured in a cell proliferation assay using PHA stimulated Jurkat cells in the presence of anti-CD3. The ED₅₀ for this effect is 1.389 μg/mL in the presence of anti-CD3 immobilized at 2 μg/mL, corresponding to a specific activity is 719.942 units/mg.

Rhesus Macaque

HEK293

C-6*His

F6QA53 (K22-R220)

/

Partial

KDSEIITVNGILGESVTFPVNIQEPQQVTNIAWTSKTSVAYVTPGDSEMAPIVAVTHRNYYERIHALGPKYDLVISDLRMEDAGDYKADINTQAEPYTTTKRYNLQVYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEEQELTYTCTAQNPVSNNSDSISARQLCADIAMGLR

Approximately 35-50 kDa due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.