CD9 Protein, Human (HEK293, His)

CD9 protein is an integral membrane protein that plays a critical regulatory role in processes such as sperm-egg fusion, platelet activation, and cell adhesion. CD9 is critical for sperm-egg fusion, coordinating multi-protein complexes on the oocyte surface. CD9 Protein, Human (HEK293, His) is the recombinant human-derived CD9 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CD9 Protein, Human (HEK293, His) is 84 a.a., with molecular weight of ~10 kDa.

CD9, an integral membrane protein, plays a pivotal role in regulating various biological processes, including sperm-egg fusion, platelet activation and aggregation, and cell adhesion. Located at the cell surface of oocytes, CD9 is essential for sperm-egg fusion, potentially by orchestrating multiprotein complexes and membrane morphology required for the fusion process. In myoblasts, CD9 associates with CD81 and PTGFRN, inhibiting myotube fusion during muscle regeneration. Within macrophages, CD9 forms associations with CD81 and beta-1/beta-2 integrins, preventing macrophage fusion into multinucleated giant cells specialized in ingesting complement-opsonized large particles. CD9 also hinders the fusion of mononuclear cell progenitors into osteoclasts responsible for bone resorption. Beyond its role in fusion events, CD9 acts as a receptor for PSG17 and is implicated in platelet activation, aggregation, paranodal junction formation, cell adhesion, cell motility, and tumor metastasis. CD9 forms disulfide-linked homodimers and higher homooligomers, as well as heterooligomers with other tetraspanin family members. It interacts with integrins ITGAV:ITGB3 and ITGA6:ITGB1, and is part of integrin-tetraspanin complexes in the membrane of monocytes/macrophages. CD9 forms complexes with CD63, PTGFRN, IGSF8, CR2/CD21, and PDPN, playing a crucial role in diverse cellular functions and interactions in various contexts.

Data is not available.

Human

HEK293

C-6*His

P21926 (S112-I195)

928  [NCBI]

SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI

Approximately 10 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.