1. Recombinant Proteins
  2. CD Antigens Complement System Biotinylated Proteins
  3. B Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins Platelet CD Proteins Dendritic Cell CD Proteins Endothelial cell CD Proteins Complement Receptor
  4. CD93
  5. CD93/C1qR1 Protein, Human (Biotinylated, HEK293, His-Avi)

CD93/C1qR1 Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P78098
Handling Instructions Technical Support

The CD93/C1qR1 protein is thought to be a receptor or part of a larger complex and plays a crucial role in immune recognition by binding to C1q, mannose-binding lectin (MBL2), and pulmonary surfactant protein A (SPA) .Its interaction with these immune factors suggests a role in coordinating the innate immune response.CD93/C1qR1 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD93/C1qR1 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

The CD93/C1qR1 protein is thought to be a receptor or part of a larger complex and plays a crucial role in immune recognition by binding to C1q, mannose-binding lectin (MBL2), and pulmonary surfactant protein A (SPA) .Its interaction with these immune factors suggests a role in coordinating the innate immune response.CD93/C1qR1 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD93/C1qR1 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

CD93/C1qR1 Protein, identified as a receptor or a component of a larger receptor complex, plays a crucial role in immune recognition by serving as a binding site for C1q, mannose-binding lectin (MBL2), and pulmonary surfactant protein A (SPA). Its interaction with these immune factors suggests a role in orchestrating innate immune responses. CD93/C1qR1 may also participate in the modulation of phagocytosis in monocytes and macrophages, particularly when interacting with soluble defense collagens. Additionally, it appears to be involved in intercellular adhesion, indicating a potential role in cellular interactions beyond immune recognition. The observed interaction with C1QBP further implies its association with cell surface C1q, highlighting the intricate involvement of CD93/C1qR1 in immune-related processes and suggesting its significance in cellular responses to external challenges.

Species

Human

Source

HEK293

Tag

C-Avi;C-8*His

Accession

Q9NPY3 (T22-K580)

Gene ID
Molecular Construction
N-term
C1qR1 (T22-K580)
Accession # Q9NPY3
8*His-Avi
C-term
Protein Length

Partial

Conjugation

Biotin

Synonyms
C1q/MBL/SPA receptor; C1qR; C1qR(p); C1qRp; CDw93; CD93; C1QR1; MXRA4; ECSM3; dJ737E23.1
AA Sequence

TGADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQK

Predicted Molecular Mass
61.2 kDa
분자량

Approximately 90-110 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

CD93/C1qR1 Protein, Human (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
CD93/C1qR1 Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P78098
수량:
MCE Japan Authorized Agent: