CD99 Protein, Human (HEK293, Fc)

The CD99 protein is involved in the important T cell adhesion process and helps red blood cells spontaneously form rosettes. It also contributes to the later stages of leukocyte extravasation, helping leukocytes to overcome the endothelial basement membrane during the immune response. CD99 Protein, Human (HEK293, Fc) is the recombinant human-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD99 Protein, Human (HEK293, Fc) is 100 a.a., with molecular weight of ~58.0 kDa.

CD99 protein participates in crucial T-cell adhesion processes, contributing to spontaneous rosette formation with erythrocytes. Additionally, it plays a vital role in the late stages of leukocyte extravasation, aiding leukocytes in overcoming the endothelial basement membrane during immune responses. Remarkably, its function is independent of PECAM1, although it acts at the same site. The involvement of CD99 in T-cell adhesion processes underscores its significance in mediating cellular interactions essential for immune function.

Human

HEK293

C-hFc

P14209 (D23-D122)

4267  [NCBI]

DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEAD

Approximately 58.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.