Copy Link Print Information

CD99 Protein, Mouse (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

CD99 Protein facilitates T-cell adhesion and aids leukocytes in crossing the endothelial basement membrane during leukocyte extravasation. It functions alongside PECAM1 but acts independently. CD99 Protein forms a homodimer and interacts with PILRB. CD99 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for CD99 Protein, Mouse (HEK293, Fc)
  • Experimental Validation Results for CD99 Protein, Mouse (HEK293, Fc)
  • CD99 Protein, Mouse (HEK293, Fc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CD99 Protein facilitates T-cell adhesion and aids leukocytes in crossing the endothelial basement membrane during leukocyte extravasation. It functions alongside PECAM1 but acts independently. CD99 Protein forms a homodimer and interacts with PILRB. CD99 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

CD99 Protein is involved in T-cell adhesion processes and plays a crucial role in a late step of leukocyte extravasation, assisting leukocytes in overcoming the endothelial basement membrane. It operates at the same site as PECAM1, but functions independently. CD99 Protein forms a homodimer and interacts with PILRB.

Verified Bioactivity

Immobilized Mouse CD99 Protein at 5 µg/mL (100 µL/well) can bind Mouse PILR-alpha protein. The ED50 for this effect is 0.2712 μg/mL, corresponding to a specific activity is 3687.316 Unit/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Immobilized Mouse CD99 Protein at 5 µg/mL (100 µL/well) can bind Mouse PILR-alpha protein. The ED50 for this effect is 0.2712 μg/mL, corresponding to a specific activity is 3687.316 Unit/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-hFc
  • Accession

    Q8VCN6/NP_079860.2 (D29-G137)

  • Gene ID
    673094  [NCBI]
  • Molecular Construction
    • N-term
    • CD99 (D29-G137)
      Accession # Q8VCN6
    • hFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD99; MIC2 (Monoclonal Antibody 12E7); Prev. MIC2X; Cell Surface Antigen 12E7; Prev. MIC2Y; Cell Surface Antigen O13; Prev. MIC2; Surface Antigen MIC2; CD99 Antigen; CD99 Molecule; Antigen Identified By Monoclonal Antibodies 12E7, F21 And O13; Protein MIC

  • AA Sequence

    DDFNLGDALEDPNMKPTPKAPTPKKPSGGFDLEDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDEGGHGGAGGAEPEGTPQGL

  • Molecular Weight

    Approximately 47-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Immobilized Mouse CD99 Protein at 5 µg/mL (100 µL/well) can bind Mouse PILR-alpha protein. The ED50 for this effect is 0.2712 μg/mL, corresponding to a specific activity is 3687.316 Unit/mg.

  • CD99 Protein, Mouse (HEK293, Fc) Product Image
    1/16
  • Experimental Validation Results for CD99 Protein, Mouse (HEK293, Fc)
  • Experimental Validation Results for CD99 Protein, Mouse (HEK293, Fc)
  • CD99 Protein, Mouse (HEK293, Fc) Product Image