1. Recombinant Proteins
  2. CD Antigens
  3. NK Cell CD Proteins Platelet CD Proteins Erythrocyte CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins Cell Adhesion-related CD Proteins
  4. CD99/MIC2
  5. CD99 Protein, Mouse (HEK293, Fc)

CD99 Protein facilitates T-cell adhesion and aids leukocytes in crossing the endothelial basement membrane during leukocyte extravasation. It functions alongside PECAM1 but acts independently. CD99 Protein forms a homodimer and interacts with PILRB. CD99 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD99 Protein, Mouse (HEK293, Fc) is 110 a.a., with molecular weight of 47-55 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD99 Protein facilitates T-cell adhesion and aids leukocytes in crossing the endothelial basement membrane during leukocyte extravasation. It functions alongside PECAM1 but acts independently. CD99 Protein forms a homodimer and interacts with PILRB. CD99 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD99 Protein, Mouse (HEK293, Fc) is 110 a.a., with molecular weight of 47-55 kDa.

Background

CD99 Protein is involved in T-cell adhesion processes and plays a crucial role in a late step of leukocyte extravasation, assisting leukocytes in overcoming the endothelial basement membrane. It operates at the same site as PECAM1, but functions independently. CD99 Protein forms a homodimer and interacts with PILRB.

Biological Activity

Immobilized Mouse CD99 Protein at 5 µg/mL (100 µL/well) can bind Mouse PILR-alpha protein. The ED50 for this effect is 0.2712 μg/mL, corresponding to a specific activity is 3687.316 Unit/mg.

  • Immobilized Mouse CD99 Protein at 5 µg/mL (100 µL/well) can bind Mouse PILR-alpha protein. The ED50 for this effect is 0.2712 μg/mL, corresponding to a specific activity is 3687.316 Unit/mg.
Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q8VCN6 (D29-G138)

Gene ID
Molecular Construction
N-term
CD99 (D29-G138)
Accession # Q8VCN6
hFc
C-term
Synonyms
CD99 Antigen; 12E7; E2 Antigen; Protein MIC2; T-Cell Surface Glycoprotein E2; CD99; MIC2; MIC2X; MIC2Y
AA Sequence

DDFNLGDALEDPNMKPTPKAPTPKKPSGGFDLEDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDEGGHGGAGGAEPEGTPQG

Molecular Weight

Approximately 47-55 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD99 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P75366
Quantity:
MCE Japan Authorized Agent: