CD99 Protein, Mouse (HEK293, Fc)

CD99 Protein facilitates T-cell adhesion and aids leukocytes in crossing the endothelial basement membrane during leukocyte extravasation. It functions alongside PECAM1 but acts independently. CD99 Protein forms a homodimer and interacts with PILRB. CD99 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD99 Protein, Mouse (HEK293, Fc) is 110 a.a., with molecular weight of 47-55 kDa.

CD99 Protein is involved in T-cell adhesion processes and plays a crucial role in a late step of leukocyte extravasation, assisting leukocytes in overcoming the endothelial basement membrane. It operates at the same site as PECAM1, but functions independently. CD99 Protein forms a homodimer and interacts with PILRB.

Immobilized Mouse CD99 Protein at 5 µg/mL (100 µL/well) can bind Mouse PILR-alpha protein. The ED₅₀ for this effect is 0.2712 μg/mL, corresponding to a specific activity is 3687.316 Unit/mg.

Mouse

HEK293

C-hFc

Q8VCN6 (D29-G138)

673094  [NCBI]

DDFNLGDALEDPNMKPTPKAPTPKKPSGGFDLEDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDEGGHGGAGGAEPEGTPQG

Approximately 47-55 kDa

Greater than 90% as determined by reducing SDS-PAGE

Solution

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.