1. Recombinant Proteins
  2. Enzymes & Regulators
  3. CEBPA Protein, Human (His)

CEBPA Protein, Human (His)

Cat. No.: HY-P701227
COA Handling Instructions

CEBPA protein, also known as CCAAT/enhancer-binding protein α, is a transcription factor that plays a crucial role in regulating the expression of genes related to cell differentiation, proliferation, and metabolism. The reference paragraph states that CEBPA protein interacts with TAF1A and UBTF. CEBPA Protein, Human (His) is the recombinant human-derived CEBPA protein, expressed by E. coli , with N-His labeled tag. The total length of CEBPA Protein, Human (His) is 358 a.a., with molecular weight of ~44 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $35 In-stock
10 μg $50 In-stock
50 μg $140 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CEBPA protein, also known as CCAAT/enhancer-binding protein α, is a transcription factor that plays a crucial role in regulating the expression of genes related to cell differentiation, proliferation, and metabolism. The reference paragraph states that CEBPA protein interacts with TAF1A and UBTF. CEBPA Protein, Human (His) is the recombinant human-derived CEBPA protein, expressed by E. coli , with N-His labeled tag. The total length of CEBPA Protein, Human (His) is 358 a.a., with molecular weight of ~44 kDa.

Background

CEBPA protein, also known as CCAAT/enhancer-binding protein alpha, is a transcription factor that plays a crucial role in regulating the expression of genes involved in cellular differentiation, proliferation, and metabolism. CEBPA protein interacts with TAF1A and UBTF. TAF1A is a component of the general transcription factor TFIID, which is essential for the initiation of transcription. The interaction between CEBPA and TAF1A suggests a potential involvement of CEBPA in the regulation of transcriptional activity through its association with the TFIID complex. UBTF, on the other hand, is a nucleolar protein that participates in ribosomal RNA transcription and ribosome biogenesis. The interaction between CEBPA and UBTF hints at a potential role for CEBPA in the regulation of these processes. Further investigation is needed to fully understand the functional implications of these interactions and their contribution to cellular processes governed by CEBPA protein.

Biological Activity

Data is not available.

Species

Human

Source

E. coli

Tag

N-His

Accession

P49715-1 (M1-A358)

Gene ID

1050

Molecular Construction
N-term
His
CEBPA (M1-A358)
Accession # P49715-1
C-term
Synonyms
Apoptotic cysteine protease; Apoptotic protease Mch 5; C/EBP alpha; C/ebpalpha; CAP4; Caspase 8 precursor; CBF-A; CCAAT Enhancer Binding Protein alpha; CCAAT/enhancer binding protein (C/EBP), alpha; CCAAT/enhancer-binding protein alpha; CEBP; CEBP A; CEBP alpha; Cebpa; CEBPA_HUMAN; FADD homologous; ICE/CED 3 like protease; FADD like ICE; FLICE; ICE like apoptotic protease 5; ICE8; MACH
AA Sequence

MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVMPGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPALGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA

Molecular Weight

Approximately 44 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from sterile 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CEBPA Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CEBPA Protein, Human (His)
Cat. No.:
HY-P701227
Quantity:
MCE Japan Authorized Agent: