CEBPA Protein, Human (His)

CEBPA protein, also known as CCAAT/enhancer-binding protein α, is a transcription factor that plays a crucial role in regulating the expression of genes related to cell differentiation, proliferation, and metabolism. CEBPA Protein, Human (His) is the recombinant human-derived CEBPA protein, expressed by E. coli , with N-His labeled tag.

CEBPA protein, also known as CCAAT/enhancer-binding protein alpha, is a transcription factor that plays a crucial role in regulating the expression of genes involved in cellular differentiation, proliferation, and metabolism. CEBPA protein interacts with TAF1A and UBTF. TAF1A is a component of the general transcription factor TFIID, which is essential for the initiation of transcription. The interaction between CEBPA and TAF1A suggests a potential involvement of CEBPA in the regulation of transcriptional activity through its association with the TFIID complex. UBTF, on the other hand, is a nucleolar protein that participates in ribosomal RNA transcription and ribosome biogenesis. The interaction between CEBPA and UBTF hints at a potential role for CEBPA in the regulation of these processes. Further investigation is needed to fully understand the functional implications of these interactions and their contribution to cellular processes governed by CEBPA protein.

Human

E. coli

N-6*His

P49715-1 (M1-A358)

1050

Full Length of Isoform-1

MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVMPGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPALGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA

Approximately 44 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.