CEBPA Protein, Human (His)
Based on 1 Customer Validation
CEBPA protein, also known as CCAAT/enhancer-binding protein α, is a transcription factor that plays a crucial role in regulating the expression of genes related to cell differentiation, proliferation, and metabolism. CEBPA Protein, Human (His) is the recombinant human-derived CEBPA protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
CEBPA protein, also known as CCAAT/enhancer-binding protein α, is a transcription factor that plays a crucial role in regulating the expression of genes related to cell differentiation, proliferation, and metabolism. CEBPA Protein, Human (His) is the recombinant human-derived CEBPA protein, expressed by E. coli , with N-His labeled tag.
CEBPA protein, also known as CCAAT/enhancer-binding protein alpha, is a transcription factor that plays a crucial role in regulating the expression of genes involved in cellular differentiation, proliferation, and metabolism. CEBPA protein interacts with TAF1A and UBTF. TAF1A is a component of the general transcription factor TFIID, which is essential for the initiation of transcription. The interaction between CEBPA and TAF1A suggests a potential involvement of CEBPA in the regulation of transcriptional activity through its association with the TFIID complex. UBTF, on the other hand, is a nucleolar protein that participates in ribosomal RNA transcription and ribosome biogenesis. The interaction between CEBPA and UBTF hints at a potential role for CEBPA in the regulation of these processes. Further investigation is needed to fully understand the functional implications of these interactions and their contribution to cellular processes governed by CEBPA protein.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P49715-1 (M1-A358)
-
Gene ID1050
-
Molecular Construction
-
N-term
-
6*His
-
CEBPA (M1-A358)
Accession # P49715-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
CEBPA; CCAAT/Enhancer Binding Protein (C/EBP), Alpha; Prev. CEBP; CCAAT/Enhancer Binding Protein Alpha; C/EBP-Alpha; C/EBP Alpha; CCAAT Enhancer Binding Protein Alpha; CCAAT/Enhancer-Binding Protein Alpha
-
AA Sequence
MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVMPGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPALGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA
-
Predicted Molecular Mass
37.6 kDa
-
Molecular Weight
Approximately 44 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
