1. Recombinant Proteins
  2. Others
  3. CEP57 Protein, Human (His)

CEP57 Protein, Human (His)

Cat. No.: HY-P76818
SDS COA Handling Instructions

CEP57 is a centrosomal protein that is a potential player in promoting microtubule attachment to centrosomes, possibly by forming a ring-like structure around microtubules. The protein exhibits homodimer and homooligomer formation and interacts with microtubules. CEP57 Protein, Human (GST) is the recombinant human-derived CEP57 protein, expressed by E. coli , with N-GST labeled tag. The total length of CEP57 Protein, Human (GST) is 109 a.a., with molecular weight of 35-43 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CEP57 is a centrosomal protein that is a potential player in promoting microtubule attachment to centrosomes, possibly by forming a ring-like structure around microtubules. The protein exhibits homodimer and homooligomer formation and interacts with microtubules. CEP57 Protein, Human (GST) is the recombinant human-derived CEP57 protein, expressed by E. coli , with N-GST labeled tag. The total length of CEP57 Protein, Human (GST) is 109 a.a., with molecular weight of 35-43 kDa.

Background

CEP57 (Centrosomal Protein 57) is a centrosomal protein with a potential role in microtubule attachment to centrosomes, possibly by forming ring-like structures around microtubules. Its involvement extends to mediating the nuclear translocation and mitogenic activity of the internalized growth factor FGF2, distinguishing its interaction from that of FGF1. CEP57 exists as a homodimer and homooligomer, and it interacts with microtubules, as well as with FGF2 and RAP80. Notably, it does not exhibit interaction with FGF1 or the 24 kDa isoform of FGF2. These features suggest that CEP57 plays a multifaceted role in cellular processes, including microtubule dynamics and the regulation of growth factor-mediated signaling pathways. It has to outline CEP57's potential functions in microtubule attachment, interaction with growth factors, and its oligomeric nature.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q86XR8 (S118-R226)

Gene ID
Molecular Construction
N-term
GST
CEP57 (S118-R226)
Accession # Q86XR8
C-term
Synonyms
Centrosomal protein of 57 kDa; Cep57; Translokin; KIAA0092; TSP57
AA Sequence

SKNEESKHNQELTSQLLAAENKCNLLEKQLEYMRNMIKHAEMERTSVLEKQVSLERERQHDQTHVQSQLEKLDLLEQEYNKLTTMQALAEKKMQELEAKLHEEEQERKR

Molecular Weight

Approximately 14 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CEP57 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CEP57 Protein, Human (His)
Cat. No.:
HY-P76818
Quantity:
MCE Japan Authorized Agent: