CEP57 Protein, Human (His)
Based on 1 Customer Validation
CEP57 is a centrosomal protein that is a potential player in promoting microtubule attachment to centrosomes, possibly by forming a ring-like structure around microtubules. The protein exhibits homodimer and homooligomer formation and interacts with microtubules. CEP57 Protein, Human (GST) is the recombinant human-derived CEP57 protein, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CEP57 is a centrosomal protein that is a potential player in promoting microtubule attachment to centrosomes, possibly by forming a ring-like structure around microtubules. The protein exhibits homodimer and homooligomer formation and interacts with microtubules. CEP57 Protein, Human (GST) is the recombinant human-derived CEP57 protein, expressed by E. coli , with N-GST labeled tag.
Background
CEP57 (Centrosomal Protein 57) is a centrosomal protein with a potential role in microtubule attachment to centrosomes, possibly by forming ring-like structures around microtubules. Its involvement extends to mediating the nuclear translocation and mitogenic activity of the internalized growth factor FGF2, distinguishing its interaction from that of FGF1. CEP57 exists as a homodimer and homooligomer, and it interacts with microtubules, as well as with FGF2 and RAP80. Notably, it does not exhibit interaction with FGF1 or the 24 kDa isoform of FGF2. These features suggest that CEP57 plays a multifaceted role in cellular processes, including microtubule dynamics and the regulation of growth factor-mediated signaling pathways. It has to outline CEP57's potential functions in microtubule attachment, interaction with growth factors, and its oligomeric nature.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q86XR8 (S118-R226)
-
Molecular Construction
-
N-term
-
GST
-
CEP57 (S118-R226)
Accession # Q86XR8 -
C-term
-
-
Protein Length
Partial
-
Synonyms
CEP57; Centrosomal Protein 57kDa; Centrosomal Protein 57; FGF2-Interacting Protein; Translokin; Proliferation-Inducing Protein 8; TSP57; Cep57; Centrosomal Protein Of 57 KDa; MVA2; KIAA0092; PIG8; Testis-Specific Protein 57
-
AA Sequence
SKNEESKHNQELTSQLLAAENKCNLLEKQLEYMRNMIKHAEMERTSVLEKQVSLERERQHDQTHVQSQLEKLDLLEQEYNKLTTMQALAEKKMQELEAKLHEEEQERKR
-
Predicted Molecular Mass
13.1 kDa
-
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
