CES3/CES1D Protein, Mouse (HEK293, His)
CES3/CES1D Protein, a major lipase in white adipose tissue, plays a crucial role in xenobiotic and natural substrate metabolism. It hydrolyzes triacylglycerols and monoacylglycerols, showing a preference for the latter, with susceptibility increasing as the acyl chain length decreases. Additionally, CES3/CES1D catalyzes the synthesis of fatty acid ethyl esters and hydrolyzes retinyl esters. CES3/CES1D Protein, Mouse (HEK293, His) is the recombinant mouse-derived CES3/CES1D protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CES3/CES1D Protein, a major lipase in white adipose tissue, plays a crucial role in xenobiotic and natural substrate metabolism. It hydrolyzes triacylglycerols and monoacylglycerols, showing a preference for the latter, with susceptibility increasing as the acyl chain length decreases. Additionally, CES3/CES1D catalyzes the synthesis of fatty acid ethyl esters and hydrolyzes retinyl esters. CES3/CES1D Protein, Mouse (HEK293, His) is the recombinant mouse-derived CES3/CES1D protein, expressed by HEK293 , with C-6*His labeled tag.
Background
CES3/CES1D Protein, a major lipase predominantly found in white adipose tissue, plays a crucial role in xenobiotic and natural substrate metabolism. This enzyme is involved in the hydrolysis of triacylglycerols and monoacylglycerols, exhibiting a preference for the latter. Its substrate susceptibility increases with decreasing acyl chain length of the fatty acid moiety. CES3/CES1D also catalyzes the synthesis of fatty acid ethyl esters and participates in the hydrolysis of retinyl esters.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
Q8VCT4 (Y19-E561)
-
Molecular Construction
-
N-term
-
CES3 (Y19-E561)
Accession # Q8VCT4 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Ces3; Ces1; Ces1d; TGH; Triacylglycerol hydrolase; FAEE synthase; Fatty acid ethyl ester synthase; EC:3.1.1.67; EC:3.1.1.1; Carboxylesterase 3; Carboxylesterase 1D
-
AA Sequence
YPSSPPVVNTVKGKVLGKYVNLEGFTQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNTTSYPPMCSQDAVGGQVLSELFTNRKENIPLQFSEDCLYLNIYTPADLTKNSRLPVMVWIHGGGLVVGGASTYDGLALSAHENVVVVTIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALRWVQDNIANFGGNPGSVTIFGESAGGFSVSVLVLSPLAKNLFHRAISESGVSLTAALITTDVKPIAGLVATLSGCKTTTSAVMVHCLRQKTEDELLETSLKLNLFKLDLLGNPKESYPFLPTVIDGVVLPKAPEEILAEKSFSTVPYIVGINKQEFGWIIPTLMGYPLAEGKLDQKTANSLLWKSYPTLKISENMIPVVAEKYLGGTDDLTKKKDLFQDLMADVVFGVPSVIVSRSHRDAGASTYMYEFEYRPSFVSAMRPKAVIGDHGDEIFSVFGSPFLKDGASEEETNLSKMVMKFWANFARNGNPNGGGLPHWPEYDQKEGYLKIGASTQAAQRLKDKEVSFWAELRAKESAQRPSHRE
-
Predicted Molecular Mass
62.4 kDa
-
Molecular Weight
Approximately 58-70 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
