1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. CES3/CES1D Protein, Mouse (HEK293, His)

CES3/CES1D Protein, Mouse (HEK293, His)

Cat. No.: HY-P70088
Handling Instructions

CES3/CES1D Protein, a major lipase in white adipose tissue, plays a crucial role in xenobiotic and natural substrate metabolism. It hydrolyzes triacylglycerols and monoacylglycerols, showing a preference for the latter, with susceptibility increasing as the acyl chain length decreases. Additionally, CES3/CES1D catalyzes the synthesis of fatty acid ethyl esters and hydrolyzes retinyl esters. CES3/CES1D Protein, Mouse (HEK293, His) is the recombinant mouse-derived CES3/CES1D protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CES3/CES1D Protein, Mouse (HEK293, His) is 543 a.a., with molecular weight of 58-70 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CES3/CES1D Protein, a major lipase in white adipose tissue, plays a crucial role in xenobiotic and natural substrate metabolism. It hydrolyzes triacylglycerols and monoacylglycerols, showing a preference for the latter, with susceptibility increasing as the acyl chain length decreases. Additionally, CES3/CES1D catalyzes the synthesis of fatty acid ethyl esters and hydrolyzes retinyl esters. CES3/CES1D Protein, Mouse (HEK293, His) is the recombinant mouse-derived CES3/CES1D protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CES3/CES1D Protein, Mouse (HEK293, His) is 543 a.a., with molecular weight of 58-70 kDa.

Background

CES3/CES1D Protein, a major lipase predominantly found in white adipose tissue, plays a crucial role in xenobiotic and natural substrate metabolism. This enzyme is involved in the hydrolysis of triacylglycerols and monoacylglycerols, exhibiting a preference for the latter. Its substrate susceptibility increases with decreasing acyl chain length of the fatty acid moiety. CES3/CES1D also catalyzes the synthesis of fatty acid ethyl esters and participates in the hydrolysis of retinyl esters.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q8VCT4 (Y19-E561)

Gene ID

104158  [NCBI]

Molecular Construction
N-term
CES3 (Y19-E561)
Accession # Q8VCT4
6*His
C-term
Synonyms
rMuCarboxylesterase 1D/CES3, His; CES3; carboxylesterase 3; carboxylesterase 3 (brain); EC 3.1.1; EC 3.1.1.1; ES31FLJ21736; Esterase 31; Liver carboxylesterase 31 homolog
AA Sequence

YPSSPPVVNTVKGKVLGKYVNLEGFTQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNTTSYPPMCSQDAVGGQVLSELFTNRKENIPLQFSEDCLYLNIYTPADLTKNSRLPVMVWIHGGGLVVGGASTYDGLALSAHENVVVVTIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALRWVQDNIANFGGNPGSVTIFGESAGGFSVSVLVLSPLAKNLFHRAISESGVSLTAALITTDVKPIAGLVATLSGCKTTTSAVMVHCLRQKTEDELLETSLKLNLFKLDLLGNPKESYPFLPTVIDGVVLPKAPEEILAEKSFSTVPYIVGINKQEFGWIIPTLMGYPLAEGKLDQKTANSLLWKSYPTLKISENMIPVVAEKYLGGTDDLTKKKDLFQDLMADVVFGVPSVIVSRSHRDAGASTYMYEFEYRPSFVSAMRPKAVIGDHGDEIFSVFGSPFLKDGASEEETNLSKMVMKFWANFARNGNPNGGGLPHWPEYDQKEGYLKIGASTQAAQRLKDKEVSFWAELRAKESAQRPSHRE

Molecular Weight

58-70 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CES3/CES1D Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CES3/CES1D Protein, Mouse (HEK293, His)
Cat. No.:
HY-P70088
Quantity:
MCE Japan Authorized Agent: