CHD1L Protein, Human (His-SUMO)
CHD1L protein is the ATP-binding subunit of the mitochondrial potassium channel and cooperates with CCDC51/MITOK to form a complex to promote ATP-dependent potassium current across the inner membrane (mitoK(ATP) channel). ABCB8 is essential for mitochondrial iron transport, affects cardiac function, and regulates the maturation of cytosolic iron-sulfur-containing enzymes. CHD1L Protein, Human (His-SUMO) is the recombinant human-derived CHD1L protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CHD1L protein is the ATP-binding subunit of the mitochondrial potassium channel and cooperates with CCDC51/MITOK to form a complex to promote ATP-dependent potassium current across the inner membrane (mitoK(ATP) channel). ABCB8 is essential for mitochondrial iron transport, affects cardiac function, and regulates the maturation of cytosolic iron-sulfur-containing enzymes. CHD1L Protein, Human (His-SUMO) is the recombinant human-derived CHD1L protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
Background
ABCB8 serves as the ATP-binding subunit of the mitochondrial potassium channel situated in the mitochondrial inner membrane. Teaming up with CCDC51/MITOK, it forms a protein complex localized within the mitochondria, facilitating ATP-dependent potassium currents across the inner membrane, known as the mitoK(ATP) channel. Additionally, ABCB8 plays a crucial role in mitochondrial iron transport and is essential for maintaining normal cardiac function, potentially influencing mitochondrial iron export and regulating the maturation of cytosolic iron sulfur cluster-containing enzymes. Notably, the channel activity is modulated by ATP through the ABCB8/MITOSUR subunit.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His;N-SUMO
-
Accession
Q86WJ1 (S704-P897, S885A)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
CHD1L (S704-P897, S885A)
Accession # Q86WJ1 -
C-term
-
-
Protein Length
Full Length of Macro Domain
-
Mutation
S885A
-
Mutation Definition
Natural variant
-
Synonyms
CHD1L; Chromo Domain-Containing Protein 1-Like; Chromodomain Helicase DNA Binding Protein 1 Like; Amplified In Liver Cancer Protein 1; ALC1; Amplified In Liver Cancer 1; Chromodomain-Helicase-DNA-Binding Protein 1-Like; CHDL; ATP-Dependent Chromatin Remod
-
AA Sequence
SAELDYQDPDATSLKYVSGDVTHPQAGAEDALIVHCVDDSGHWGRGGLFTALEKRSAEPRKIYELAGKMKDLSLGGVLLFPVDDKESRNKGQDLLALIVAQHRDRSNVLSGIKMAALEEGLKKIFLAAKKKKASVHLPRIGHATKGFNWYGTERLIRKHLAARGIPTYIYYFPRSKSAVLHAQSSSSSSRQLVP
-
Predicted Molecular Mass
37.3 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)