CHD1L Protein, Human (His-SUMO)

CHD1L protein is the ATP-binding subunit of the mitochondrial potassium channel and cooperates with CCDC51/MITOK to form a complex to promote ATP-dependent potassium current across the inner membrane (mitoK(ATP) channel). ABCB8 is essential for mitochondrial iron transport, affects cardiac function, and regulates the maturation of cytosolic iron-sulfur-containing enzymes. CHD1L Protein, Human (His-SUMO) is the recombinant human-derived CHD1L protein, expressed by E. coli , with N-His, N-SUMO labeled tag. The total length of CHD1L Protein, Human (His-SUMO) is 194 a.a., with molecular weight of ~37.3 kDa.

ABCB8 serves as the ATP-binding subunit of the mitochondrial potassium channel situated in the mitochondrial inner membrane. Teaming up with CCDC51/MITOK, it forms a protein complex localized within the mitochondria, facilitating ATP-dependent potassium currents across the inner membrane, known as the mitoK(ATP) channel. Additionally, ABCB8 plays a crucial role in mitochondrial iron transport and is essential for maintaining normal cardiac function, potentially influencing mitochondrial iron export and regulating the maturation of cytosolic iron sulfur cluster-containing enzymes. Notably, the channel activity is modulated by ATP through the ABCB8/MITOSUR subunit.

Human

E. coli

N-His;N-SUMO

Q86WJ1 (704S-897P)

9557  [NCBI]

SAELDYQDPDATSLKYVSGDVTHPQAGAEDALIVHCVDDSGHWGRGGLFTALEKRSAEPRKIYELAGKMKDLSLGGVLLFPVDDKESRNKGQDLLALIVAQHRDRSNVLSGIKMAALEEGLKKIFLAAKKKKASVHLPRIGHATKGFNWYGTERLIRKHLAARGIPTYIYYFPRSKSAVLHAQSSSSSSRQLVP

Approximately 37.3 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.