CHD1L Protein, Human (His-SUMO)

CHD1L protein is the ATP-binding subunit of the mitochondrial potassium channel and cooperates with CCDC51/MITOK to form a complex to promote ATP-dependent potassium current across the inner membrane (mitoK(ATP) channel). ABCB8 is essential for mitochondrial iron transport, affects cardiac function, and regulates the maturation of cytosolic iron-sulfur-containing enzymes. CHD1L Protein, Human (His-SUMO) is the recombinant human-derived CHD1L protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CHD1L protein is the ATP-binding subunit of the mitochondrial potassium channel and cooperates with CCDC51/MITOK to form a complex to promote ATP-dependent potassium current across the inner membrane (mitoK(ATP) channel). ABCB8 is essential for mitochondrial iron transport, affects cardiac function, and regulates the maturation of cytosolic iron-sulfur-containing enzymes. CHD1L Protein, Human (His-SUMO) is the recombinant human-derived CHD1L protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Background

ABCB8 serves as the ATP-binding subunit of the mitochondrial potassium channel situated in the mitochondrial inner membrane. Teaming up with CCDC51/MITOK, it forms a protein complex localized within the mitochondria, facilitating ATP-dependent potassium currents across the inner membrane, known as the mitoK(ATP) channel. Additionally, ABCB8 plays a crucial role in mitochondrial iron transport and is essential for maintaining normal cardiac function, potentially influencing mitochondrial iron export and regulating the maturation of cytosolic iron sulfur cluster-containing enzymes. Notably, the channel activity is modulated by ATP through the ABCB8/MITOSUR subunit.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His;N-SUMO
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • CHD1L (S704-P897, S885A)
      Accession # Q86WJ1
    • C-term
  • Protein Length

    Full Length of Macro Domain

  • Mutation

    S885A

  • Mutation Definition

    Natural variant

  • Synonyms

    CHD1L; Chromo Domain-Containing Protein 1-Like; Chromodomain Helicase DNA Binding Protein 1 Like; Amplified In Liver Cancer Protein 1; ALC1; Amplified In Liver Cancer 1; Chromodomain-Helicase-DNA-Binding Protein 1-Like; CHDL; ATP-Dependent Chromatin Remod

  • AA Sequence

    SAELDYQDPDATSLKYVSGDVTHPQAGAEDALIVHCVDDSGHWGRGGLFTALEKRSAEPRKIYELAGKMKDLSLGGVLLFPVDDKESRNKGQDLLALIVAQHRDRSNVLSGIKMAALEEGLKKIFLAAKKKKASVHLPRIGHATKGFNWYGTERLIRKHLAARGIPTYIYYFPRSKSAVLHAQSSSSSSRQLVP

  • Predicted Molecular Mass

    37.3 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00