1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemerin/RARRES2 Protein, Mouse (HEK293, His)

Chemerin/RARRES2 Protein, Mouse (HEK293, His)

Cat. No.: HY-P75554
COA Handling Instructions

Chemerin/RARRES2 proteins bind to signaling receptors and are involved in various processes, including promotion of adipocyte differentiation, protein phosphorylation, and insulin receptor signaling. It plays a role in brown adipocyte differentiation and is located in the extracellular region. Chemerin/RARRES2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Chemerin/RARRES2 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg $70 In-stock
10 μg $115 In-stock
50 μg $345 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Chemerin/RARRES2 proteins bind to signaling receptors and are involved in various processes, including promotion of adipocyte differentiation, protein phosphorylation, and insulin receptor signaling. It plays a role in brown adipocyte differentiation and is located in the extracellular region. Chemerin/RARRES2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Chemerin/RARRES2 protein, expressed by HEK293 , with C-His labeled tag.

Background

The Chemerin/RARRES2 protein is predicted to possess signaling receptor binding activity and is involved in various processes, including positive regulation of fat cell differentiation, positive regulation of protein phosphorylation, and regulation of insulin receptor signaling pathway. It acts upstream of or within brown fat cell differentiation and is located in the extracellular region. Chemerin/RARRES2 is expressed in the genitourinary system and retina and shares orthology with human RARRES2 (retinoic acid receptor responder 2). Biased expression of Chemerin/RARRES2 is observed in adult liver (RPKM 313.8), placenta (RPKM 166.0), and 12 other tissues, according to the Alliance of Genome Resources in April 2022.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q9DD06/NP_082128.1 (T17-S156)

Gene ID
Molecular Construction
N-term
Chemerin (M1-S156)
Accession # Q9DD06/NP_082128.1
His
C-term
Synonyms
Retinoic acid receptor responder protein 2; Chemerin; Rarres2
AA Sequence

MKCLLISLALWLGTVGTRGTEPELSETQRRSLQVALEEFHKHPPVQLAFQEIGVDRAEEVLFSAGTFVRLEFKLQQTNCPKKDWKKPECTIKPNGRRRKCLACIKMDPKGKILGRIVHCPILKQGPQDPQELQCIKIAQAGEDPHGYFLPGQFAFS

Molecular Weight

Approximately 17.4 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Chemerin/RARRES2 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Chemerin/RARRES2 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P75554
Quantity:
MCE Japan Authorized Agent: