CLIC4/Chloride intracellular channel 4 Protein, Human (His)

CLIC4/Chloride The intracellular channel 4 protein inserts into the membrane to form a pH-dependent, poorly selective ion channel that transports chloride ions.It enhances cell surface expression of HRH3 and maintains membrane polarity during angiogenesis, mitosis, cytokinesis, endothelial cell proliferation, and morphogenesis.CLIC4/Chloride intracellular channel 4 Protein, Human (His) is the recombinant human-derived CLIC4/Chloride intracellular channel 4 protein, expressed by E.coli , with N-6*His labeled tag.

CLIC4, known as Chloride Intracellular Channel 4, has the ability to insert into membranes, forming ion channels with poor selectivity, potentially facilitating chloride ion transport. Its channel activity is pH-dependent and its membrane insertion appears to be redox-regulated, occurring specifically under oxidizing conditions. Beyond ion transport, CLIC4 plays diverse roles, including promoting cell-surface expression of HRH3 and participating in various cellular functions such as angiogenesis, maintenance of apical-basolateral membrane polarity during mitosis and cytokinesis, as well as regulation of endothelial cell proliferation and morphogenesis. It is a part of a multimeric complex involving cytoskeletal proteins like actin, ezrin, alpha-actinin, gelsolin, IQGAP1, and CLIC5A. CLIC4 interacts directly with brain dynamin I within a complex containing actin, tubulin, and 14-3-3 isoforms, and it also interacts with HRH3 and AKAP9.

Human

E. coli

N-6*His

Q9Y696 (M1-K253)

25932  [NCBI]

Full Length

MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK

Approximately 32 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, 1 mM DTT, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.