Chlorite Dismutase/Cld Protein, Dechloromonas aromatica (His)
Based on 1 Customer Validation
Chlorite dismutase/Cld protein is a key enzyme in cellular metabolism that catalyzes the conversion of chlorite into chloride and oxygen. This enzyme activity plays a key role in the detoxification of chlorite, a harmful compound used in various industrial processes. Chlorite Dismutase/Cld Protein, Dechloromonas aromatica (His) is the recombinant Chlorite Dismutase/Cld protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Others
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Chlorite dismutase/Cld protein is a key enzyme in cellular metabolism that catalyzes the conversion of chlorite into chloride and oxygen. This enzyme activity plays a key role in the detoxification of chlorite, a harmful compound used in various industrial processes. Chlorite Dismutase/Cld Protein, Dechloromonas aromatica (His) is the recombinant Chlorite Dismutase/Cld protein, expressed by E. coli , with N-6*His labeled tag.
Background
BBOX1 protein plays a pivotal role in cellular metabolism by catalyzing the formation of L-carnitine from gamma-butyrobetaine. This enzymatic activity is a crucial step in the carnitine biosynthetic pathway, contributing to the synthesis of L-carnitine, an essential molecule involved in the transport of fatty acids into the mitochondria for β-oxidation. BBOX1's function in this pathway is instrumental for maintaining cellular energy homeostasis, as L-carnitine serves as a cofactor in fatty acid metabolism, facilitating their efficient utilization as a source of energy. The catalytic activity of BBOX1 underscores its significance in regulating key metabolic processes and highlights its role as a key player in cellular energy metabolism.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag N-6*His
-
Accession
Q47CX0 (M35-D282)
-
Gene ID/
-
Molecular Construction
-
N-term
-
6*His
-
Cld (M35-D282)
Accession # Q47CX0 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Chlorite dismutase; EC:1.13.11.49; Chlorite O(2)-lyase; Daro_2580; rDeChlorite dismutase/Cld, His; Cld
-
AA Sequence
MQPMQSMKIERGTILTQPGVFGVFTMFKLRPDWNKVPVAERKGAAEEVKKLIEKHKDNVLVDLYLTRGLETNSDFFFRINAYDLAKAQTFMREFRSTTVGKNADVFETLVGVTKPLNYISKDKSPGLNAGLSSATYSGPAPRYVIVIPVKKNAEWWNMSPEERLKEMEVHTTPTLAYLVNVKRKLYHSTGLDDTDFITYFETDDLTAFNNLMLSLAQVKENKFHVRWGSPTTLGTIHSPEDVIKALAD
-
Predicted Molecular Mass
31.3 kDa
-
Molecular Weight
Approximately 32 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 0.5 mM EDTA, 4% sucrose, 0.02% Tween 80, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
