CHODL Protein, Rat (HEK293, Fc)

CHODL proteins contribute significantly to nervous system development, particularly in neurite growth and elongation. There is evidence that it is involved in guiding motor axon growth and shaping the structural framework of the nervous system. CHODL Protein, Rat (HEK293, Fc) is the recombinant rat-derived CHODL protein, expressed by HEK293 , with C-hFc labeled tag.

CHODL protein appears to be a significant contributor to the intricate processes underlying nervous system development, particularly in the realms of neurite outgrowth and elongation. Evidence suggests its potential involvement in guiding motor axon growth, emphasizing its role in shaping the structural framework of the nervous system. Through interactions with proteins like RABGGTB, CHODL likely engages in intricate molecular mechanisms that influence axon development and navigation. The comprehensive understanding of CHODL's functions, especially its impact on neurite dynamics and motor axon guidance, holds promise for unraveling key aspects of neural development and may contribute to insights into therapeutic strategies targeting nervous system disorders.

Rat

HEK293

C-hFc

D3ZI86 (R22-N216)

288289  [NCBI]

Partial

RRVVSGQKVCFADVKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWIGLLRSGDGQTSGACPDLYQWSDGSSSQFRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEIHPTEPVEKPYLTNQPEDTHENVVVTEAGIIPN

Approximately 60 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.