CHODL Protein, Rat (HEK293, His)
Based on 1 Customer Validation
CHODL proteins contribute significantly to nervous system development, particularly in neurite growth and elongation. There is evidence that it is involved in guiding motor axon growth and shaping the structural framework of the nervous system. CHODL Protein, Rat (HEK293, His) is the recombinant rat-derived CHODL protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CHODL proteins contribute significantly to nervous system development, particularly in neurite growth and elongation. There is evidence that it is involved in guiding motor axon growth and shaping the structural framework of the nervous system. CHODL Protein, Rat (HEK293, His) is the recombinant rat-derived CHODL protein, expressed by HEK293 , with C-His labeled tag.
Background
CHODL protein appears to be a significant contributor to the intricate processes underlying nervous system development, particularly in the realms of neurite outgrowth and elongation. Evidence suggests its potential involvement in guiding motor axon growth, emphasizing its role in shaping the structural framework of the nervous system. Through interactions with proteins like RABGGTB, CHODL likely engages in intricate molecular mechanisms that influence axon development and navigation. The comprehensive understanding of CHODL's functions, especially its impact on neurite dynamics and motor axon guidance, holds promise for unraveling key aspects of neural development and may contribute to insights into therapeutic strategies targeting nervous system disorders.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. When Recombinant Rat Chondrolectin Protein is immobilized at 1µg/mL (100 µL/well) can bind Recombinant Human IGFBP-5. The ED50 for this effect is 9.923 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-6*His
-
Accession
D3ZI86 (R22-N216)
-
Molecular Construction
-
N-term
-
CHODL (R22-N216)
Accession # D3ZI86 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CHODL; MT75; Prev. C21orf68; FLJ12627; PRED12; Chromosome 21 Open Reading Frame 68; Chondrolectin; Transmembrane Protein MT75
-
AA Sequence
RRVVSGQKVCFADVKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWIGLLRSGDGQTSGACPDLYQWSDGSSSQFRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEIHPTEPVEKPYLTNQPEDTHENVVVTEAGIIPN
-
Molecular Weight
Approximately 33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)