CHRNA1 Protein, Tetronarce californica (His-SUMO)

The CHRNA1 Protein, recognized as the acetylcholine receptor (AChR), undergoes a crucial conformational shift upon acetylcholine binding. This alteration affects all subunits, activating an ion-conducting channel across the plasma membrane. The pentameric structure includes two alpha chains, in addition to one each of the beta, delta, and gamma chains. CHRNA1 Protein, Tetronarce californica (His-SUMO) is the recombinant CHRNA1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag. The total length of CHRNA1 Protein, Tetronarce californica (His-SUMO) is 210 a.a., with molecular weight of ~40.8 kDa.

The CHRNA1 protein, also known as the acetylcholine receptor (AChR), undergoes a significant conformational change upon binding to acetylcholine, impacting all subunits and resulting in the activation of an ion-conducting channel across the plasma membrane. It is comprised of a pentamer, consisting of two alpha chains, along with one each of the beta, delta, and gamma chains.

Others

E. coli

N-6*His;N-SUMO

P02710 (S25-I234)

/

SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRI

Approximately 40.8 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm sterile filtered PBS,6% Trehalose, pH 7.4

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.