Claudin-6/CLDN6 Protein-VLP, Cynomolgus (HEK293)

Claudin-6/CLDN6 Protein-VLP, Cynomolgus (HEK293) is recommended for SPR analysis, animal immunization, ELISA, PK assay. If VLP control is required, it is recommended HY-P702775. May have binding signals with Anti-His antibodies.

Claudin-6/CLDN6 Protein-VLP, Cynomolgus, assumes a crucial role in the specific obliteration of the intercellular space within tight junctions, exerting its function through calcium-independent cell-adhesion activity. The protein's participation in tight junction formation underscores its significance in mediating cellular adhesion and maintaining the integrity of intercellular connections. As a key component of the tight junction complex, Claudin-6/CLDN6 contributes to the regulation of paracellular transport and barrier functions, crucial for the maintenance of tissue homeostasis and the prevention of unwanted substance passage between cells. This calcium-independent cell-adhesion activity highlights the protein's essential role in cellular architecture and the establishment of selective permeability within tissues.

Immobilized Cynomolgus Claudin 6 VLP at 5μg/ml (100μl/Well) on the plate. Dose response curve for Anti-Claudin6 Antibody, mFc Tag with the EC₅₀ of 5.1 ng/ml determined by ELISA.

Cynomolgus

HEK293

Tag Free

G7Q0B0 (M1-V220)

102140361  [NCBI]

Full Length

MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSRGPSHYMARYSTSAPAISRGPSEYPTKNYV

≥ 95%, as determined by HPLC.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, 300 mM L-Arginine, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.