1. Recombinant Proteins
  2. Others
  3. Claudin-6/CLDN6 Protein-VLP, Cynomolgus (HEK293)

Claudin-6/CLDN6 Protein-VLP, Cynomolgus (HEK293) is recommended for SPR analysis, animal immunization, ELISA, PK assay. If VLP control is required, it is recommended HY-P702775. May have binding signals with Anti-His antibodies.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
Muestra gratis   Apply now
Muestra gratis   Apply now
10 μg En stock
50 μg En stock
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

Claudin-6/CLDN6 Protein-VLP, Cynomolgus (HEK293) is recommended for SPR analysis, animal immunization, ELISA, PK assay. If VLP control is required, it is recommended HY-P702775. May have binding signals with Anti-His antibodies.

Background

Claudin-6/CLDN6 Protein-VLP, Cynomolgus, assumes a crucial role in the specific obliteration of the intercellular space within tight junctions, exerting its function through calcium-independent cell-adhesion activity. The protein's participation in tight junction formation underscores its significance in mediating cellular adhesion and maintaining the integrity of intercellular connections. As a key component of the tight junction complex, Claudin-6/CLDN6 contributes to the regulation of paracellular transport and barrier functions, crucial for the maintenance of tissue homeostasis and the prevention of unwanted substance passage between cells. This calcium-independent cell-adhesion activity highlights the protein's essential role in cellular architecture and the establishment of selective permeability within tissues.

Actividad biológica

Immobilized Cynomolgus Claudin 6 VLP at 5μg/ml (100μl/Well) on the plate. Dose response curve for Anti-Claudin6 Antibody, mFc Tag with the EC50 of 5.1 ng/ml determined by ELISA.

Species

Cynomolgus

Source

HEK293

Tag

Tag Free

Accession

G7Q0B0 (M1-V220)

Gene ID
Molecular Construction
N-term
CLDN6 (M1-V220)
Accession # G7Q0B0
C-term
Protein Length

Full Length

Synonyms
Claudin-6; Skullin; CLDN6; Claudin6; Skullin 2; EGM_11390; Claudin
AA Sequence

MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSRGPSHYMARYSTSAPAISRGPSEYPTKNYV

Predicted Molecular Mass
24.6 kDa
Pureza

≥ 95%, as determined by HPLC.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, 300 mM L-Arginine, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Envío

Shipping with dry ice.

Documentación

Claudin-6/CLDN6 Protein-VLP, Cynomolgus (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

Claudin-6/CLDN6 Protein-VLP, Cynomolgus (HEK293)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
Claudin-6/CLDN6 Protein-VLP, Cynomolgus (HEK293)
Cat. No.:
HY-P700691
Cantidad:
MCE Japan Authorized Agent: