1. Recombinant Proteins
  2. Others
  3. Claudin-9/CLDN9 Protein-Nanodisc, Human (Biotinylated, HEK293, His, Avi)

Claudin-9/CLDN9 Protein-Nanodisc, Human (Biotinylated, HEK293, His, Avi)

Cat. No.: HY-P703891
Handling Instructions Technical Support

Claudin-9/CLDN9 protein-VLP plays a crucial role in tight junctions by eliminating intercellular spaces through calcium-independent cell adhesion activity. In microbial infections, it acts as a receptor that facilitates the entry of hepatitis C virus (HCV) into hepatocytes. Claudin-9/CLDN9 Protein-Nanodisc, Human (Biotinylated, HEK293, His, Avi) is the recombinant human-derived Claudin-9/CLDN9 protein, expressed by HEK293, with C-His and C-Avi labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Claudin-9/CLDN9 protein-VLP plays a crucial role in tight junctions by eliminating intercellular spaces through calcium-independent cell adhesion activity. In microbial infections, it acts as a receptor that facilitates the entry of hepatitis C virus (HCV) into hepatocytes. Claudin-9/CLDN9 Protein-Nanodisc, Human (Biotinylated, HEK293, His, Avi) is the recombinant human-derived Claudin-9/CLDN9 protein, expressed by HEK293, with C-His and C-Avi labeled tag.

Background

Claudin-9/CLDN9 Protein-VLP assumes a pivotal role in the specific obliteration of the intercellular space within tight junctions, employing calcium-independent cell-adhesion activity. Notably, in the context of microbial infection, this protein acts as a receptor facilitating the entry of hepatitis C virus (HCV) into hepatic cells. The dual functionality of Claudin-9/CLDN9 underscores its significance in regulating cell adhesion at tight junctions, contributing to the maintenance of tissue integrity, while also serving as a crucial entry point for HCV, highlighting its relevance in viral infection processes.

Species

Human

Source

HEK293

Tag

C-His;Avi

Accession

O95484 (M1-T184)

Gene ID

9080

Protein Length

Partial

Conjugation

Biotin

Synonyms
Claudin-9; CLD9
AA Sequence

MASTGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLLALLGLLVAITGAQCTTCVEDEGAKARIVLTAGVILLLAGILVLIPVCWTAHAIIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGLLCCT

Predicted Molecular Mass
22.4 kDa
Purity

≥ 80%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Claudin-9/CLDN9 Protein-Nanodisc, Human (Biotinylated, HEK293, His, Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Claudin-9/CLDN9 Protein-Nanodisc, Human (Biotinylated, HEK293, His, Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Claudin-9/CLDN9 Protein-Nanodisc, Human (Biotinylated, HEK293, His, Avi)
Cat. No.:
HY-P703891
Quantity:
MCE Japan Authorized Agent: