Claudin-9/CLDN9 Protein-Nanodisc, Human (Biotinylated, HEK293, His, Avi)

Claudin-9/CLDN9 protein-VLP plays a crucial role in tight junctions by eliminating intercellular spaces through calcium-independent cell adhesion activity. In microbial infections, it acts as a receptor that facilitates the entry of hepatitis C virus (HCV) into hepatocytes. Claudin-9/CLDN9 Protein-Nanodisc, Human (Biotinylated, HEK293, His, Avi) is the recombinant human-derived Claudin-9/CLDN9 protein, expressed by HEK293, with C-His and C-Avi labeled tag.

Claudin-9/CLDN9 Protein-VLP assumes a pivotal role in the specific obliteration of the intercellular space within tight junctions, employing calcium-independent cell-adhesion activity. Notably, in the context of microbial infection, this protein acts as a receptor facilitating the entry of hepatitis C virus (HCV) into hepatic cells. The dual functionality of Claudin-9/CLDN9 underscores its significance in regulating cell adhesion at tight junctions, contributing to the maintenance of tissue integrity, while also serving as a crucial entry point for HCV, highlighting its relevance in viral infection processes.

Human

HEK293

C-His;Avi

O95484 (M1-T184)

9080

Partial

Biotin

MASTGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLLALLGLLVAITGAQCTTCVEDEGAKARIVLTAGVILLLAGILVLIPVCWTAHAIIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGLLCCT

≥ 80%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. /biology-dictionary/kms-12-bm-cell.html  [Content Brief]