CLIC3 Protein, Human (His)
Based on 1 Customer Validation
The CLIC3 protein is a multifunctional molecule capable of integrating into membranes and forming chloride channels. It has been implicated in potential roles related to cell growth control. CLIC3 Protein, Human (His) is the recombinant human-derived CLIC3 protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The CLIC3 protein is a multifunctional molecule capable of integrating into membranes and forming chloride channels. It has been implicated in potential roles related to cell growth control. CLIC3 Protein, Human (His) is the recombinant human-derived CLIC3 protein, expressed by E. coli , with C-6*His labeled tag.
CLIC3 protein is a versatile molecule capable of integrating into membranes and forming chloride ion channels. It has been implicated in potential roles related to cellular growth control. Notably, CLIC3 is associated with the C-terminal region of MAPK15, a member of the mitogen-activated protein kinase (MAPK) family. The precise mechanisms and functions of CLIC3 in cellular processes, including growth control and ion channel regulation, require further exploration to fully understand its contributions to normal physiology and disease states.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
O95833 (M1-R236)
-
Molecular Construction
-
N-term
-
CLIC3 (M1-R236)
Accession # O95833 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
CLIC3; Glutaredoxin-Like Oxidoreductase CLIC3; Chloride Intracellular Channel 3; Chloride Intracellular Channel Protein; Chloride Intracellular Channel Protein 3
-
AA Sequence
MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR
-
Predicted Molecular Mass
27.7 kDa
-
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 200 mM Sucrose, 0.05% Tween 80 (w/v), pH 8.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
