CLM9/CD300g Protein, Rat (HEK293, His)
Based on 1 Customer Validation
The CLM9/CD300g protein is known as a receptor and is thought to be involved in mediating L-selectin-dependent lymphocyte rolling. This protein exhibits calcium-dependent binding to SELL (L-selectin ligand), indicating its ability to interact with lymphocytes and potentially influence lymphocyte-related processes. CLM9/CD300g Protein, Rat (HEK293, His) is the recombinant rat-derived CLM9/CD300g protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The CLM9/CD300g protein is known as a receptor and is thought to be involved in mediating L-selectin-dependent lymphocyte rolling. This protein exhibits calcium-dependent binding to SELL (L-selectin ligand), indicating its ability to interact with lymphocytes and potentially influence lymphocyte-related processes. CLM9/CD300g Protein, Rat (HEK293, His) is the recombinant rat-derived CLM9/CD300g protein, expressed by HEK293 , with C-His labeled tag.
Background
CLM9/CD300g protein, known as a receptor, is thought to be involved in mediating lymphocyte rolling that is dependent on L-selectin. This protein exhibits calcium-dependent binding to SELL (L-selectin ligand), suggesting its ability to interact with lymphocytes and potentially influence lymphocyte-related processes. The presence of CLM9/CD300g protein implies its significance in cellular adhesion and migration, particularly in the context of lymphocyte function. Further research is necessary to fully understand the precise mechanisms and functions of this protein, but its involvement in lymphocyte rolling and interaction underscores its potential importance in immune responses and lymphocyte-mediated processes.
Verified Bioactivity
Measured by its ability to inhibit anti-CD3 antibody induced IL-2 secretion by human T cells. The ED50 for this effect is 1.244 μg/mL. Corresponding to a specific activity is 803.859 U/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-6*His
-
Accession
XP_002724611.1 (L19-R160)
-
Molecular Construction
-
N-term
-
CD300LG (L19-R160)
Accession # XP_002724611 -
His
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
CD300LG; Nepmucin; CD300 Molecule Like Family Member G; TREM-4; CLM9; CLM-9; Trem4; CD300 Molecule-Like Family Member G; Triggering Receptor Expressed On Myeloid Cells 4; CD300 Antigen Like Family Member G; CD300 Antigen-Like Family Member G; CD300g Antig
-
AA Sequence
LTGPKEISGFEGDTVSLRCTYKKEMKVHRKYWCRQGGILLSRCGDTVYTNQDQEVTRGKMSIRDSLQDLWVTVTMRDLTLKDSGKYWCGIDRLGRDESFEVKLIVFPGSSRPVIWPPLTTPKDSRAVTSSVSKSSVSIPMVR
-
Molecular Weight
Approximately 28 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
