CLM9/CD300g Protein, Rat (HEK293, His)

The CLM9/CD300g protein is known as a receptor and is thought to be involved in mediating L-selectin-dependent lymphocyte rolling. This protein exhibits calcium-dependent binding to SELL (L-selectin ligand), indicating its ability to interact with lymphocytes and potentially influence lymphocyte-related processes. CLM9/CD300g Protein, Rat (HEK293, His) is the recombinant rat-derived CLM9/CD300g protein, expressed by HEK293 , with C-His labeled tag. The total length of CLM9/CD300g Protein, Rat (HEK293, His) is 160 a.a., with molecular weight of 25-30 kDa.

CLM9/CD300g protein, known as a receptor, is thought to be involved in mediating lymphocyte rolling that is dependent on L-selectin. This protein exhibits calcium-dependent binding to SELL (L-selectin ligand), suggesting its ability to interact with lymphocytes and potentially influence lymphocyte-related processes. The presence of CLM9/CD300g protein implies its significance in cellular adhesion and migration, particularly in the context of lymphocyte function. Further research is necessary to fully understand the precise mechanisms and functions of this protein, but its involvement in lymphocyte rolling and interaction underscores its potential importance in immune responses and lymphocyte-mediated processes.

Measured by its ability to inhibit anti-CD3 antibody induced IL-2 secretion by human T cells. The ED₅₀ for this effect is 1.244 μg/mL. Corresponding to a specific activity is 803.859 U/mg.

Rat

HEK293

C-6*His

XP_002724611.1 (L19-R160)

684984  [NCBI]

LTGPKEISGFEGDTVSLRCTYKKEMKVHRKYWCRQGGILLSRCGDTVYTNQDQEVTRGKMSIRDSLQDLWVTVTMRDLTLKDSGKYWCGIDRLGRDESFEVKLIVFPGSSRPVIWPPLTTPKDSRAVTSSVSKSSVSIPMVR

Approximately 25-30 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.