Copy Link Print Information

Clusterin/APOJ Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

Clusterin/APOJ Protein, Human (HEK 293, His) expresses in HEK 293 cells with a His tag at the C-terminus. Clusterin (CLU) is a multifunctional glycoprotein that has been implicated in several physiological and pathological states, including Alzheimer’s disease (AD).

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Clusterin/APOJ Protein, Human (HEK293, His)
  • Experimental Validation Results for Clusterin/APOJ Protein, Human (HEK293, His)
  • Clusterin/APOJ Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Clusterin/APOJ Protein, Human (HEK 293, His) expresses in HEK 293 cells with a His tag at the C-terminus. Clusterin (CLU) is a multifunctional glycoprotein that has been implicated in several physiological and pathological states, including Alzheimer’s disease (AD)[1].

Background

Clusterin is a ubiquitously and constitutively expressed protein found in a wide range of tissues and bodily fluids. Clusterin’s ability to interact and bind to Aβ appears to alter aggregation and promote Aβ clearance, suggesting a neuroprotective role[1].

Verified Bioactivity

Measured by its ability to induce clustering of Caki-2 human clear cell carcinoma epithelial cells.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to induce clustering of Caki‑2 human clear cell carcinoma epithelial cells.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession

    P10909-1 (D23-E449)

  • Gene ID
    1191  [NCBI]
  • Molecular Construction
    • N-term
    • Clusterin (D23-E449)
      Accession # P10909-1
    • His
    • C-term
  • Protein Length

    Full Length of Clusterin Chain

  • Synonyms

    CLU; Complement-Associated Protein SP-40,40; Prev. APOJ; Complement Lysis Inhibitor; Prev. CLI; Ku70-Binding Protein 1; Apolipoprotein J; NA1/NA2; TRPM-2; Clusterin (Complement Lysis Inhibitor, SP-40,40, Sulfated Glycoprotein 2, Testosterone-Repressed Prostate Message 2, Apolipoprotein J); SGP-2; Epididymis Secretory Sperm Binding Protein; KUB1; Aging-Associated Gene 4 Protein; Testosterone-Repressed Prostate Message 2; Aging-Associated Protein 4; Sulfated Glycoprotein 2; APO-J; SP-40; Apo-J; CLU2; SGP2; CLU1; AAG4; Clusterin; Complement Cytolysis Inhibitor

  • AA Sequence

    DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE

  • Molecular Weight

    Approximately 38-40 kDa, based on SDS-PAGE under reducing conditions

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Evangeline M Foster, et al. Clusterin in Alzheimer's Disease: Mechanisms, Genetics, and Lessons From Other Pathologies. Front Neurosci. 2019 Feb 28;13:164. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to induce clustering of Caki‑2 human clear cell carcinoma epithelial cells.

  • Clusterin/APOJ Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Clusterin/APOJ Protein, Human (HEK293, His)
  • Experimental Validation Results for Clusterin/APOJ Protein, Human (HEK293, His)
  • Clusterin/APOJ Protein, Human (HEK293, His) Product Image