1. Recombinant Proteins
  2. Complement System
  3. Complement Regulatory Proteins
  4. Clusterin/APOJ Protein, Human (427a.a, HEK293, His)

Clusterin/APOJ Protein, Human (427a.a, HEK293, His)

Cat. No.: HY-P7895
Handling Instructions

Clusterin/APOJ Protein, Human (HEK 293, His) expresses in HEK 293 cells with a His tag at the N-terminus. Clusterin (CLU) is a multifunctional glycoprotein that has been implicated in several physiological and pathological states, including Alzheimer’s disease (AD)[1].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $90 In-stock
Estimated Time of Arrival: December 31
50 μg $270 Get quote
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Clusterin/APOJ Protein, Human (427a.a, HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products

Clusterin/APOJ Protein, Human (427a.a, HEK293, His) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

HEK 293

Accession

P10909 (D23-E449)

Gene ID

1191

Synonyms
rHuClusterin/APOJ, His ; Clusterin; Aging-Associated Gene 4 Protein; Apolipoprotein J; Apo-J; Complement Cytolysis Inhibitor; CLI; Complement-Associated Protein SP-40; Ku70-Binding Protein 1; NA1/NA2; Testosterone-Repressed Prostate Message 2; TRPM-2; CLU; APOJ; CLI; KUB1
AA Sequence

DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE

Molecular Weight

28-40 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Clusterin is a ubiquitously and constitutively expressed protein found in a wide range of tissues and bodily fluids. Clusterin’s ability to interact and bind to Aβ appears to alter aggregation and promote Aβ clearance, suggesting a neuroprotective role[1].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Clusterin/APOJ Protein, Human (427a.a, HEK293, His)
Cat. No.:
HY-P7895
Quantity:
MCE Japan Authorized Agent: