Clusterin/APOJ Protein, Human (HEK293, His)

Clusterin/APOJ Protein, Human (HEK 293, His) expresses in HEK 293 cells with a His tag at the N-terminus. Clusterin (CLU) is a multifunctional glycoprotein that has been implicated in several physiological and pathological states, including Alzheimer’s disease (AD)^[1].

Clusterin is a ubiquitously and constitutively expressed protein found in a wide range of tissues and bodily fluids. Clusterin’s ability to interact and bind to Aβ appears to alter aggregation and promote Aβ clearance, suggesting a neuroprotective role^[1].

Measured by its ability to induce clustering of Caki-2 human clear cell carcinoma epithelial cells.

• 
  Measured by its ability to induce clustering of Caki‑2 human clear cell carcinoma epithelial cells.

Human

HEK293

C-His

P10909 (D23-E449)

1191  [NCBI]

DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE

Approximately (28-40)& 60.96 kDa

• 
  Greater than 90% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Evangeline M Foster, et al. Clusterin in Alzheimer's Disease: Mechanisms, Genetics, and Lessons From Other Pathologies. Front Neurosci. 2019 Feb 28;13:164.  [Content Brief]