Clusterin-like protein 1/CLUL1 Protein, Human (HEK293, His)

Clusterin-like protein 1/CLUL1 Protein belongs to the clusterin family. Clusterin-like protein 1/CLUL1 Protein, Human (HEK293, His) is the recombinant human-derived Clusterin-like protein 1/CLUL1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Clusterin-like protein 1/CLUL1 Protein, Human (HEK293, His) is 422 a.a., with molecular weight of 59-80 kDa.

Claudin-18/CLDN18.2 Protein-VLP, Macaca fascicularis, is a member of the claudin family. It is associated with macaques and is likely utilized for vaccine-related applications. Clusterin-like protein 1/CLUL1 Protein is a member of the clusterin family, involved in various cellular processes, potentially implicated in neuroprotection and cell survival mechanisms.

Human

HEK293

C-6*His

Q15846 (A21-A442)

27098  [NCBI]

APTWKDKTAISENLKSFSEVGEIDADEEVKKALTGIKQMKIMMERKEKEHTNLMSTLKKCREEKQEALKLLNEVQEHLEEEERLCRESLADSWGECRSCLENNCMRIYTTCQPSWSSVKNKIERFFRKIYQFLFPFHEDNEKDLPISEKLIEEDAQLTQMEDVFSQLTVDVNSLFNRSFNVFRQMQQEFDQTFQSHFISDTDLTEPYFFPAFSKEPMTKADLEQCWDIPNFFQLFCNFSVSIYESVSETITKMLKAIEDLPKQDKAPDHGGLISKMLPGQDRGLCGELDQNLSRCFKFHEKCQKCQAHLSEDCPDVPALHTELDEAIRLVNVSNQQYGQILQMTRKHLEDTAYLVEKMRGQFGWVSELANQAPETEIIFNSIQVVPRIHEGNISKQDETMMTDLSILPSSNFTLKIPLEESA

The protein migrates as 59-80 kDa under reducing SDS-PAGE due to glycosylation.

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0 or 50 mM Tris-HCL, 300 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.