COL4A3 Protein, Human (His)

The COL4A3 protein is an important type IV collagen component that, together with laminin, proteoglycans, and nestin/nesidin, plays a role in forming the "chicken wire" network structure in the glomerular basement membrane (GBM). Key role. Its cleavage product tumstatin is derived from the NC1 domain of collagen α 3(IV) and has dual anti-angiogenic and anti-tumor cell activities. COL4A3 Protein, Human (His) is the recombinant human-derived COL4A3 protein, expressed by E. coli , with N-6*His labeled tag.

COL4A3 protein, a crucial component of type IV collagen, serves as the major structural element in glomerular basement membranes (GBM), participating in the formation of a 'chicken-wire' meshwork alongside laminins, proteoglycans, and entactin/nidogen. Notably, tumstatin, a cleavage fragment derived from the collagen alpha 3(IV) NC1 domain, exhibits dual anti-angiogenic and anti-tumor cell activities. The regulation of these anti-tumor properties appears to involve RGD-independent mechanisms mediated by ITGB3, highlighting the intricate role of COL4A3 in influencing angiogenesis and tumor cell behavior.

Human

E. coli

N-6*His

Q01955 (G1427-K1668)

1285  [NCBI]

Partial

GLKGKRGDSGSPATWTTRGFVFTRHSQTTAIPSCPEGTVPLYSGFSFLFVQGNQRAHGQDLGTLGSCLQRFTTMPFLFCNVNDVCNFASRNDYSYWLSTPALMPMNMAPITGRALEPYISRCTVCEGPAIAIAVHSQTTDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASPGSCLEEFRASPFLECHGRGTCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGELEKIISRCQVCMKK

Approximately 30.6 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm solution of PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.