COL4A3 Protein, Human (His)
Based on 1 Customer Validation
The COL4A3 protein is an important type IV collagen component that, together with laminin, proteoglycans, and nestin/nesidin, plays a role in forming the "chicken wire" network structure in the glomerular basement membrane (GBM). Key role. Its cleavage product tumstatin is derived from the NC1 domain of collagen α 3(IV) and has dual anti-angiogenic and anti-tumor cell activities. COL4A3 Protein, Human (His) is the recombinant human-derived COL4A3 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The COL4A3 protein is an important type IV collagen component that, together with laminin, proteoglycans, and nestin/nesidin, plays a role in forming the "chicken wire" network structure in the glomerular basement membrane (GBM). Key role. Its cleavage product tumstatin is derived from the NC1 domain of collagen α 3(IV) and has dual anti-angiogenic and anti-tumor cell activities. COL4A3 Protein, Human (His) is the recombinant human-derived COL4A3 protein, expressed by E. coli , with N-6*His labeled tag.
COL4A3 protein, a crucial component of type IV collagen, serves as the major structural element in glomerular basement membranes (GBM), participating in the formation of a 'chicken-wire' meshwork alongside laminins, proteoglycans, and entactin/nidogen. Notably, tumstatin, a cleavage fragment derived from the collagen alpha 3(IV) NC1 domain, exhibits dual anti-angiogenic and anti-tumor cell activities. The regulation of these anti-tumor properties appears to involve RGD-independent mechanisms mediated by ITGB3, highlighting the intricate role of COL4A3 in influencing angiogenesis and tumor cell behavior.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q01955 (G1427-K1668)
-
Molecular Construction
-
N-term
-
6*His
-
COL4A3 (G1427-K1668)
Accession # Q01955 -
C-term
-
-
Protein Length
Partial
-
Synonyms
COL4A3; Goodpasture Antigen; Collagen Type IV Alpha 3 Chain; ATS3A; Collagen, Type IV, Alpha 3 (Goodpasture Antigen); ATS3B; Collagen Alpha-3(IV) Chain; ATS2; Tumstatin; ATS3; Collagen IV, Alpha-3 Polypeptide; BFH2; Collagen IV Alpha 3 Chain
-
AA Sequence
GLKGKRGDSGSPATWTTRGFVFTRHSQTTAIPSCPEGTVPLYSGFSFLFVQGNQRAHGQDLGTLGSCLQRFTTMPFLFCNVNDVCNFASRNDYSYWLSTPALMPMNMAPITGRALEPYISRCTVCEGPAIAIAVHSQTTDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASPGSCLEEFRASPFLECHGRGTCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGELEKIISRCQVCMKK
-
Predicted Molecular Mass
30.6 kDa
-
Molecular Weight
Approximately 34 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
