1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. COLAER_02088 Protein, Collinsella aerofaciens (T189V, V207M, GST)

COLAER_02088 Protein, Collinsella aerofaciens (T189V, V207M, GST)

Art. -Nr.: HY-P702132
Handling Instructions Technical Support

The COLAER_02088 Protein, acting as a 7beta-hydroxysteroid dehydrogenase, transforms 7-oxo-lithocholate into chemopreventive UDCA in the human colon, showcasing its role in bile acid metabolism. This enzyme also exhibits reversible reactions, oxidizing UDCA and utilizing NADPH as its preferred electron acceptor, influencing bile acid dynamics and potential therapeutic applications. COLAER_02088 Protein, Collinsella aerofaciens (T189V, V207M, GST) is the recombinant COLAER_02088 protein, expressed by E. coli , with N-GST labeled tag.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Größe Verfügbarkeit
50 μg   Angebot einholen  
100 μg   Angebot einholen  

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

Top Publications Citing Use of Products
  • Biologische Aktivität

  • Technical Parameters

  • Properties

  • Beschreibung

Beschreibung

The COLAER_02088 Protein, acting as a 7beta-hydroxysteroid dehydrogenase, transforms 7-oxo-lithocholate into chemopreventive UDCA in the human colon, showcasing its role in bile acid metabolism. This enzyme also exhibits reversible reactions, oxidizing UDCA and utilizing NADPH as its preferred electron acceptor, influencing bile acid dynamics and potential therapeutic applications. COLAER_02088 Protein, Collinsella aerofaciens (T189V, V207M, GST) is the recombinant COLAER_02088 protein, expressed by E. coli , with N-GST labeled tag.

Background

The COLAER_02088 Protein, known as 7beta-hydroxysteroid dehydrogenase, acts as an enzyme that facilitates the reduction of the 7-oxo group of 7-oxo-lithocholate (7-oxo-LCA), resulting in the production of ursodeoxycholate (UDCA). Given that C.aerofaciens is an intestinal bacterium, it is likely that this enzyme plays a role in the formation of UDCA in the human colon. UDCA is considered a beneficial secondary bile acid with chemopreventive properties due to its low hydrophobicity, which helps safeguard hepatocytes and bile duct epithelial cells against necrosis and apoptosis induced by more hydrophobic secondary bile acids such as deoxycholate (DCA) (Probable). Additionally, this enzyme has the ability to catalyze the reverse reaction, oxidizing the 7beta-hydroxy group of UDCA back to 7-oxo-LCA. It also exhibits some activity on the taurine- and glycine-conjugates of ursodeoxycholate, albeit to a lesser extent. Notably, COLAER_02088 Protein specifically utilizes NADPH/NADP(+) as the electron acceptor/donor, as it is not active with NADH/NAD(+). Furthermore, when NADPH is present, 7beta-HSDH can also reduce dehydrocholate. Lastly, it has been shown to have the capability to oxidize ursocholate.

Species

Others

Source

E. coli

Tag

N-GST

Accession

A4ECA9 (M1-D263, T189V, V207M)

Gene ID

/

Molecular Construction
N-term
GST
COLAER_02088 (M1-D263, T189V, V207M)
Accession # A4ECA9
C-term
Protein Length

Full Length

Synonyms
7beta-hydroxysteroid dehydrogenase; 7beta-HSDH; NADP-dependent 7beta-hydroxysteroid dehydrogenase
AA Sequence

MNLREKYGEWGLILGATEGVGKAFCEKIAAGGMNVVMVGRREEKLNVLAGEIRETYGVETKVVRADFSQPGAAETVFAATEGLDMGFMSYVACLHSFGKIQDTPWEKHEAMINVNVVTFLKCFHHYMRIFAAQDRGAVINVSSMTGISSSPWNGQYGAGKAFILKMTEAVACECEGTGVDVEVITLGTVLTPSLLSNLPGGPQGEAMMKIALTPEECVDEAFEKLGKELSVIAGQRNKDSVHDWKANHTEDEYIRYMGSFYRD

Reinheit

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Dokumentation

COLAER_02088 Protein, Collinsella aerofaciens (T189V, V207M, GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Ihre kürzlich angesehenen Produkte:

Online-Anfrage

Your information is safe with us. * Required Fields.

COLAER_02088 Protein, Collinsella aerofaciens (T189V, V207M, GST)

 

Requested Quantity *

Name des Antragstellers *

 

Anrede

E-Mail-Addresse *

 

Telefonnummer *

Department

 

Name der Organisation *

City

Bundesland

Country or Region *

     

Bemerkungen

Massenanfrage

Inquiry Information

Produktname:
COLAER_02088 Protein, Collinsella aerofaciens (T189V, V207M, GST)
Art. -Nr.:
HY-P702132
Menge:
MCE Japan Authorized Agent: