1. Recombinant Proteins
  2. Others
  3. Collectin-11/CL-K1 Protein, Mouse (HEK293, His)

Collectin-11/CL-K1 Protein, Mouse (HEK293, His)

Cat. No.: HY-P70067
COA Handling Instructions

Collectin-11/CL-K1 Protein is a secreted protein that activates tyrosine kinase receptors (EGFR, HER3) and ERK, JNK, and AKT signaling pathways to promote cell proliferation. Collectin-11/CL-K1 Protein plays an important role in innate immunity and apoptosis. Collectin-11/CL-K1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Collectin-11/CL-K1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Collectin-11/CL-K1 Protein, Mouse (HEK293, His) is 246 a.a., with molecular weight of 30-35 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $115 In-stock
50 μg $345 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Collectin-11/CL-K1 Protein is a secreted protein that activates tyrosine kinase receptors (EGFR, HER3) and ERK, JNK, and AKT signaling pathways to promote cell proliferation. Collectin-11/CL-K1 Protein plays an important role in innate immunity and apoptosis. Collectin-11/CL-K1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Collectin-11/CL-K1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Collectin-11/CL-K1 Protein, Mouse (HEK293, His) is 246 a.a., with molecular weight of 30-35 kDa.

Background

Collectin-11 is a secreted protein that plays an important role in innate immunity by binding to carbohydrate antigens on microorganisms and activating complement by recruiting mannose-binding lectins (MBL) associated serine proteases (MASPs). Collectin-11 can activate tyrosine kinase receptors (EGFR, HER3) and ERK, JNK and AKT signaling pathways, which can directly stimulate the proliferation of mouse melanoma cells. Collectin-11 plays a role in apoptosis by binding to DNA on the surface of apoptotic cells in a calcium-independent manner and activating complement in response to this binding. Collectin-11 plays a protective role in urinary tract infections (UTI) induced by uropathogenic Escherichia coli (UPEC) by inducing innate immune defense[1][2][3][4][5].

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q3SXB8-1 (Q27-L272)

Gene ID

71693  [NCBI]

Molecular Construction
N-term
CL-K1 (Q27-L272)
Accession # Q3SXB8-1
6*His
C-term
Synonyms
rMuCollectin-11, His ; Collectin-11; Collectin Kidney Protein 1; CL-K1; Colec11
AA Sequence

QQTTEDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGTVGRHGKIGPIGAKGEKGDSGDIGPPGPSGEPGIPCECSQLRKAIGEMDNQVTQLTTELKFIKNAVAGLRETESKIYLLVKEEKRYADAQLSCQARGGTLSMPKDEAANGLMASYLAQAGLARVFIGINDLEKEGAFVYSDRSPMQTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHITMYFMCEFDKENL

Molecular Weight

30-35 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Collectin-11/CL-K1 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Collectin-11/CL-K1 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P70067
Quantity:
MCE Japan Authorized Agent: