Complement C5/C5a Protein, Pig (P.pastoris, His)

Complement C5/C5a Protein, a component of the complement system, is involved in the immune response and inflammation. It is cleaved to generate C5a, a potent pro-inflammatory mediator. Complement C5/C5a Protein's role in immune regulation and its potential as a therapeutic target make it a promising candidate for the treatment of inflammatory disorders and autoimmune diseases. Complement C5/C5a Protein, Pig (P.pastoris, His) is the recombinant pig-derived Complement C5/C5a protein, expressed by P. pastoris , with N-His labeled tag. The total length of Complement C5/C5a Protein, Pig (P.pastoris, His) is 74 a.a., with molecular weight of ~10.6 kDa.

Derived from the proteolytic degradation of complement C5, Complement C5a protein serves as a pivotal mediator in local inflammatory processes. Upon binding to its receptor, C5AR1, C5a elicits diverse responses, including the release of intracellular calcium, smooth muscle contraction, heightened vascular permeability, and histamine release from mast cells and basophilic leukocytes. Functioning as a potent chemokine, C5a actively stimulates the migration of polymorphonuclear leukocytes, directing their movement towards sites of inflammation. The interaction with C5AR1 is central to orchestrating these immunomodulatory effects.

Pig

P. pastoris

N-His

P01032 (1M-74R)

414437  [NCBI]

MLQKKIEEEAAKYKYAMLKKCCYDGAYRNDDETCEERAARIKIGPKCVKAFKDCCYIANQVRAEQSHKNIQLGR

Approximately 10.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.