Complement C5a anaphylatoxin Protein, Pig (P.pastoris, His)
Complement C5/C5a Protein, a component of the complement system, is involved in the immune response and inflammation. It is cleaved to generate C5a, a potent pro-inflammatory mediator. Complement C5/C5a Protein's role in immune regulation and its potential as a therapeutic target make it a promising candidate for the treatment of inflammatory disorders and autoimmune diseases. Complement C5a anaphylatoxin Protein, Pig (P.pastoris, His) is the recombinant pig-derived Complement C5a anaphylatoxin protein, expressed by P. pastoris , with N-His labeled tag.
- Species: Pig
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Complement C5/C5a Protein, a component of the complement system, is involved in the immune response and inflammation. It is cleaved to generate C5a, a potent pro-inflammatory mediator. Complement C5/C5a Protein's role in immune regulation and its potential as a therapeutic target make it a promising candidate for the treatment of inflammatory disorders and autoimmune diseases. Complement C5a anaphylatoxin Protein, Pig (P.pastoris, His) is the recombinant pig-derived Complement C5a anaphylatoxin protein, expressed by P. pastoris , with N-His labeled tag.
Derived from the proteolytic degradation of complement C5, Complement C5a protein serves as a pivotal mediator in local inflammatory processes. Upon binding to its receptor, C5AR1, C5a elicits diverse responses, including the release of intracellular calcium, smooth muscle contraction, heightened vascular permeability, and histamine release from mast cells and basophilic leukocytes. Functioning as a potent chemokine, C5a actively stimulates the migration of polymorphonuclear leukocytes, directing their movement towards sites of inflammation. The interaction with C5AR1 is central to orchestrating these immunomodulatory effects.
Technical Parameters
-
Species Pig
-
Source P. pastoris
-
Tag N-His
-
Accession
P01032 (M1-R74)
-
Molecular Construction
-
N-term
-
His
-
C5a (M1-R74)
Accession # P01032 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
C5; C3 And PZP-Like Alpha-2-Macroglobulin Domain-Containing Protein 4; Complement C5; C5a Anaphylatoxin; CPAMD4; Prepro-C5; Complement Component 5; Anaphylatoxin C5a Analog; C5a; ECLZB; C5b; C5D
-
AA Sequence
MLQKKIEEEAAKYKYAMLKKCCYDGAYRNDDETCEERAARIKIGPKCVKAFKDCCYIANQVRAEQSHKNIQLGR
-
Predicted Molecular Mass
10.6 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
