1. Recombinant Proteins
  2. Others
  3. Corneodesmosin/CDSN Protein, Human (HEK293, His)

PSORS1C1/CDSN, a keratin protein present in cornified desmosomes, is involved in the repair of human epidermis and other keratinized squamous epithelium. The expression of PSORS1C1/CDSN is associated with immune skin diseases such as psoriasis, and Cdsn deficiency causes skin barrier damage. Corneodesmosin/CDSN Protein, Human (HEK293, His) is the recombinant human-derived Corneodesmosin/CDSN protein, expressed by HEK293 , with C-6*His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
10 μg En stock
50 μg En stock
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

PSORS1C1/CDSN, a keratin protein present in cornified desmosomes, is involved in the repair of human epidermis and other keratinized squamous epithelium. The expression of PSORS1C1/CDSN is associated with immune skin diseases such as psoriasis, and Cdsn deficiency causes skin barrier damage. Corneodesmosin/CDSN Protein, Human (HEK293, His) is the recombinant human-derived Corneodesmosin/CDSN protein, expressed by HEK293 , with C-6*His labeled tag.

Background

PSORS1C1/CDSN is a corneodesmosin found in corneodesmosomes, which are localized in human epidermis and other keratinized squamous epithelium. PSORS1C1/CDSN is encoded by CDSN and primarily contributes to susceptibility to psoriasis, an immunodermatological disease. CDSN is polymorphic in the human population and is associated with ankylosing spondylitis (AS), psoriasis, hypotrichosis, and desquamation syndrome. Pediatric dermatosis, in particular, is caused by an autosomal recessive biallelic mutation in CDSN. In epidermal-specific Cdsn-deficient mouse models, epidermal barrier disruption occurs and epidermal cytokine production is increased.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

AAH31993.1 (K33-P528)

Gene ID
Molecular Construction
N-term
CDSN (K33-P528)
Accession # AAH31993.1
6*His
C-term
Protein Length

Partial

Synonyms
rHuCorneodesmosin/CDSN, His; Corneodesmosin; S Protein; CDSN
AA Sequence

KSIGTFSDPCKDPTRITSPNDPCLTGKGDSSGFSSYSGSSSSGSSISSARSSGGGSSGSSSGSSIAQGGSAGSFKPGTGYSQVSYSSGSGSSLQGASGSSQLGSSSSHSGNSGSHSGSSSSHSSSSSSFQFSSSSFQVGNGSALPTNDNSYRGILNPSQPGQSSSSSQTFGVSSSGQSVSSNQRPCSSDIPDSPCSGGPIVSHSGPYIPSSHSVSGGQRPVVVVVDQHGSGAPGVVQGPPCSNGGLPGKPCPPITSVDKSYGGYEVVGGSSDSYLVPGMTYSKGKIYPVGYFTKENPVKGSPGVPSFAAGPPISEGKYFSSNPIIPSQSAASSAIAFQPVGTGGVQLCGGGSTGSKGPCSPSSSRVPSSSSISSSSGLPYHPCGSASQSPCSPPGTGSFSSSSSSQSSGKIILQPCGSKSSSSGHPCMSVSSLTLTGGPDGSPHPDPSAGAKPCGSSSAGKIPCRSIRDILAQVKPLGPQLADPEVFLPQGELLNSP

Peso molecular

58-70 kDa

Pureza
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación

Corneodesmosin/CDSN Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

Corneodesmosin/CDSN Protein, Human (HEK293, His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
Corneodesmosin/CDSN Protein, Human (HEK293, His)
Cat. No.:
HY-P7820
Cantidad:
MCE Japan Authorized Agent: