1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. COX4I1 Protein, Human (His-SUMO)

The COX4I1 protein is a component of cytochrome c oxidase, the final enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. COX4I1 Protein, Human (His-SUMO) is the recombinant human-derived COX4I1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The COX4I1 protein is a component of cytochrome c oxidase, the final enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. COX4I1 Protein, Human (His-SUMO) is the recombinant human-derived COX4I1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Background

COX4I1, a vital constituent of the cytochrome c oxidase, serves as a pivotal component in the mitochondrial electron transport chain, culminating in oxidative phosphorylation. This respiratory chain encompasses three multisubunit complexes—succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV)—that collaboratively facilitate the transfer of electrons from NADH and succinate to molecular oxygen. This intricate process generates an electrochemical gradient across the inner membrane, propelling transmembrane transport and fueling ATP synthase. Specifically, cytochrome c oxidase orchestrates the reduction of oxygen to water. The electron transfer from reduced cytochrome c in the intermembrane space involves intermediates, such as the dinuclear copper A center (CU(A)) in subunit 2 and heme A in subunit 1, ultimately converging at the active site in subunit 1—a binuclear center (BNC) comprised of heme A3 and copper B (CU(B)). The BNC efficiently reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c in the intermembrane space and four protons from the mitochondrial matrix. COX4I1 thus plays a central role in energy metabolism, contributing to the intricate processes of oxidative phosphorylation.

Species

Human

Source

E. coli

Tag

N-6*His;N-SUMO

Accession

P13073 (A23-K169)

Gene ID
Molecular Construction
N-term
6*His-SUMO
COX4I1 (A23-K169)
Accession # P13073
C-term
Protein Length

Full Length of Mature Protein

Synonyms
AL024441; COX 4; COX IV 1; COX IV; COX IV-1; Cox4; COX41_HUMAN; Cox4a; COX4B; COX4I1; COX4I2; COX4L2; COXIV; Cytochrome c oxidase polypeptide IV; Cytochrome c oxidase subunit 4 isoform 1 mitochondrial; Cytochrome c oxidase subunit 4 isoform 1, mitochondrial; Cytochrome C Oxidase subunit IV; Cytochrome c oxidase subunit IV isoform 1; Cytochrome c oxidase subunit IV isoform 2 lung; ; Cytochrome c oxydase subunit 4; dJ857M17.2; MGC105470; MGC72016
AA Sequence

AHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK

Predicted Molecular Mass
33.2 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

COX4I1 Protein, Human (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

COX4I1 Protein, Human (His-SUMO)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
COX4I1 Protein, Human (His-SUMO)
Cat. No.:
HY-P72150
Quantity:
MCE Japan Authorized Agent: