COX5B Protein, Human (His)
Based on 1 Customer Validation
The COX5B protein is a component of cytochrome c oxidase, the final enzyme in the mitochondrial electron transport chain. COX5B Protein, Human (His) is the recombinant human-derived COX5B protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
The COX5B protein is a component of cytochrome c oxidase, the final enzyme in the mitochondrial electron transport chain. COX5B Protein, Human (His) is the recombinant human-derived COX5B protein, expressed by E. coli , with N-His labeled tag.
COX5B, an integral component of the cytochrome c oxidase, stands as the final enzyme in the mitochondrial electron transport chain, orchestrating oxidative phosphorylation. This respiratory chain encompasses three crucial multisubunit complexes—succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV)—cooperatively facilitating the transfer of electrons derived from NADH and succinate to molecular oxygen. This intricate process generates an electrochemical gradient across the inner membrane, propelling transmembrane transport and driving ATP synthase. Cytochrome c oxidase serves as the linchpin of the respiratory chain, catalyzing the reduction of oxygen to water. Electrons, originating from reduced cytochrome c in the intermembrane space, traverse through intermediates like the dinuclear copper A center (CU(A)) in subunit 2 and heme A in subunit 1. Ultimately, this electron transfer converges at the active site in subunit 1, forming a binuclear center (BNC) composed of heme A3 and copper B (CU(B)). The BNC efficiently reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c in the intermembrane space and four protons from the mitochondrial matrix. COX5B plays a pivotal role in energy metabolism, contributing significantly to the intricate processes of oxidative phosphorylation.
Immobilized Recombinant Human COX5B at 2 μg/mL (100 μL/well) can bind COX5B antibody. The ED50 for this effect is 0.2333 μg/mL.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-10*His
-
Accession
P10606 (A32-H129)
-
Molecular Construction
-
N-term
-
His
-
COX5B (A32-H129)
Accession # P10606 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
COX5B; Cytochrome C Oxidase Subunit Vb; Cytochrome C Oxidase Subunit 5B; Cytochrome C Oxidase Polypeptide VB, Mitochondrial; Cytochrome C Oxidase Subunit 5B, Mitochondrial; Epididymis Secretory Sperm Binding Protein; Cytochrome C Oxidase Polypeptide Vb; C
-
AA Sequence
ASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH
-
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 10% Glycerin.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)