1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. COX5B Protein, Human (His)

COX5B Protein, Human (His)

Cat. No.: HY-P75686
COA Handling Instructions

The COX5B protein is a component of cytochrome c oxidase, the final enzyme in the mitochondrial electron transport chain. COX5B Protein, Human (His) is the recombinant human-derived COX5B protein, expressed by E. coli , with N-His labeled tag. The total length of COX5B Protein, Human (His) is 98 a.a., with molecular weight of ~14 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $50 In-stock
10 μg $75 In-stock
50 μg $190 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The COX5B protein is a component of cytochrome c oxidase, the final enzyme in the mitochondrial electron transport chain. COX5B Protein, Human (His) is the recombinant human-derived COX5B protein, expressed by E. coli , with N-His labeled tag. The total length of COX5B Protein, Human (His) is 98 a.a., with molecular weight of ~14 kDa.

Background

COX5B, an integral component of the cytochrome c oxidase, stands as the final enzyme in the mitochondrial electron transport chain, orchestrating oxidative phosphorylation. This respiratory chain encompasses three crucial multisubunit complexes—succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV)—cooperatively facilitating the transfer of electrons derived from NADH and succinate to molecular oxygen. This intricate process generates an electrochemical gradient across the inner membrane, propelling transmembrane transport and driving ATP synthase. Cytochrome c oxidase serves as the linchpin of the respiratory chain, catalyzing the reduction of oxygen to water. Electrons, originating from reduced cytochrome c in the intermembrane space, traverse through intermediates like the dinuclear copper A center (CU(A)) in subunit 2 and heme A in subunit 1. Ultimately, this electron transfer converges at the active site in subunit 1, forming a binuclear center (BNC) composed of heme A3 and copper B (CU(B)). The BNC efficiently reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c in the intermembrane space and four protons from the mitochondrial matrix. COX5B plays a pivotal role in energy metabolism, contributing significantly to the intricate processes of oxidative phosphorylation.

Biological Activity

Immobilized Recombinant Human COX5B at 2 μg/mL (100 μL/well) can bind COX5B antibody. The ED50 for this effect is 0.2333 μg/mL.

  • Immobilized Recombinant Human COX5B at 2 μg/mL (100 μL/well) can bind COX5B antibody. The ED50 for this effect is 0.2333 μg/mL.
Species

Human

Source

E. coli

Tag

N-10*His

Accession

P10606 (A32-H129)

Gene ID
Molecular Construction
N-term
His
COX5B (A32-H129)
Accession # P10606
C-term
Synonyms
Cytochrome c oxidase subunit 5B, mitochondrial; COX5B
AA Sequence

ASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH

Molecular Weight

Approximately 14 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 10% Glycerin.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

COX5B Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
COX5B Protein, Human (His)
Cat. No.:
HY-P75686
Quantity:
MCE Japan Authorized Agent: