1. Recombinant Proteins
  2. Viral Proteins
  3. Coxsackievirus A16 VP4 Protein (68a.a, sf9, Fc)

Coxsackievirus A16 VP4 Protein (68a.a, sf9, Fc)

Cat. No.: HY-P76281
Handling Instructions Technical Support

Coxsackievirus A16 (CVA16) can cause hand-foot-and-mouth disease (HFMD). CVA16 is a small, non-enveloped, icosahedral particle containing a single-stranded, positive-sense viral RNA genome of approximately 7.4 kb in length. CVA16 can be cleaved by viral proteases into 4 structural (VP1 to VP4) and 7 nonstructural (2A to 2C, and 3A to 3D) proteins. CVA16 interacts with its host receptors (cell surface heparan sulfate glycosaminoglycans and SCARB2 as its uncoating receptor) to enter into susceptible cells. Upon binding, CVA16 mature virions may transform to an uncoating intermediate state. Coxsackievirus A16 VP1 Protein is one of the capsid subunit protein of cleaved CVA16. Coxsackievirus A16 VP4 Protein (68a.a, sf9, Fc) is the recombinant Virus-derived Coxsackievirus A16 VP4 protein, expressed by Sf9 insect cells , with C-rFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

Coxsackievirus A16 (CVA16) can cause hand-foot-and-mouth disease (HFMD). CVA16 is a small, non-enveloped, icosahedral particle containing a single-stranded, positive-sense viral RNA genome of approximately 7.4 kb in length. CVA16 can be cleaved by viral proteases into 4 structural (VP1 to VP4) and 7 nonstructural (2A to 2C, and 3A to 3D) proteins. CVA16 interacts with its host receptors (cell surface heparan sulfate glycosaminoglycans and SCARB2 as its uncoating receptor) to enter into susceptible cells. Upon binding, CVA16 mature virions may transform to an uncoating intermediate state. Coxsackievirus A16 VP1 Protein is one of the capsid subunit protein of cleaved CVA16[1][2]. Coxsackievirus A16 VP4 Protein (68a.a, sf9, Fc) is the recombinant Virus-derived Coxsackievirus A16 VP4 protein, expressed by Sf9 insect cells , with C-rFc labeled tag.

Background

Coxsackievirus A16 (CVA16) can cause hand-foot-and-mouth disease (HFMD), a common acute infectious disease. CVA16 is a small, non-enveloped, icosahedral particle containing a single-stranded, positive-sense viral RNA genome of approximately 7.4 kb in length. CVA16 can be cleaved by viral proteases into 4 structural (VP1 to VP4) and 7 nonstructural (2A to 2C, and 3A to 3D) proteins[1]. Therefore, Coxsackievirus A16 VP1 Protein is one of the capsid subunit protein of cleaved CVA16.
CVA16 interacts with its host receptors (cell surface heparan sulfate glycosaminoglycans and SCARB2, also known as LIMP-2 as its uncoating receptor) to enter into susceptible cells. Upon binding, CVA16 mature virions may transform to an uncoating intermediate state, termed the “135S-like particle” or “A-particle”, with the feature of expanded capsid, loss of pocket factor, and an enlarged two-fold opening[2].

Species

Virus

Source

Sf9 insect cells

Tag

C-rFc

Accession

AAA50478.1 (G2-K69)

Gene ID

1461111  [NCBI]

Molecular Construction
N-term
Cox A16 VP4 (G2-K69)
Accession # AAA50478.1
rFc
C-term
Protein Length

Full Length of Pico_P1A

Synonyms
Coxsackievirus A16 (Cox A16) (strain G-10) VP4 Protein; VP4 Protein; CV
AA Sequence

GSQVSTQRSGSHENSNSASEGSTINYTTINYYKDAYAASAGRQDMSQDPKKFTDPVMDVIHEMAPPLK

Predicted Molecular Mass
32.6 kDa
Purity

≥ 85%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류
References

Coxsackievirus A16 VP4 Protein (68a.a, sf9, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Coxsackievirus A16 VP4 Protein (68a.a, sf9, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Coxsackievirus A16 VP4 Protein (68a.a, sf9, Fc)
Cat. No.:
HY-P76281
수량:
MCE Japan Authorized Agent: