CS6 fimbrial subunit B/cssB Protein, E.coli (His-SUMO)
CS6 fimbrial subunit B (cssB) is a component of E.coli CS6 operon. CssB is a structural subunit which binds to cell surface sulfatide and is a key factor for binding to host cells. CssB is also required for stabilization of CssA, maximal adhesion of E.coli to epithelial cells and CS6 assembly. CS6 fimbrial subunit B/cssB Protein, E.coli (His-SUMO) is the recombinant E. coli-derived CS6 fimbrial subunit B/cssB protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
- Species: E.coli
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CS6 fimbrial subunit B (cssB) is a component of E.coli CS6 operon. CssB is a structural subunit which binds to cell surface sulfatide and is a key factor for binding to host cells. CssB is also required for stabilization of CssA, maximal adhesion of E.coli to epithelial cells and CS6 assembly. CS6 fimbrial subunit B/cssB Protein, E.coli (His-SUMO) is the recombinant E. coli-derived CS6 fimbrial subunit B/cssB protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
Background
CS6 fimbrial subunit B (cssB) is a component of E.coli CS6 operon. CssB is a structural subunit which binds to cell surface sulfatide and is a key factor for binding to host cells. CssA can inhibit the CssB-mediated binding as another structural subunit of CS6. CssB is also required for stabilization of CssA, while all css genes are necessary for maximal adhesion of E.coli to epithelial cells and CS6 assembly[1].
Technical Parameters
-
Species E.coli
-
Source E. coli
-
Tag N-His;N-SUMO
-
Accession
P53510 (G22-N167)
-
Gene ID/
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
cssB (G22-N167)
Accession # P53510 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CS6 fimbrial subunit B; cssB
-
AA Sequence
GNWQYKSLDVNVNIEQNFIPDIDSAVRIIPVNYDSDPKLNSQLYTVEMTIPAGVSAVKIVPTDSLTSSGQQIGKLVNVNNPDQNMNYYIRKDSGAGKFMAGQKGSFSVKENTSYTFSAIYTGGEYPNSGYSSGTYAGHLTVSFYSN
-
Predicted Molecular Mass
31.9 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
