CS6 fimbrial subunit B/cssB Protein, E.coli (His-SUMO)

CS6 fimbrial subunit B (cssB) is a component of E.coli CS6 operon. CssB is a structural subunit which binds to cell surface sulfatide and is a key factor for binding to host cells. CssB is also required for stabilization of CssA, maximal adhesion of E.coli to epithelial cells and CS6 assembly. CS6 fimbrial subunit B/cssB Protein, E.coli (His-SUMO) is the recombinant E. coli-derived CS6 fimbrial subunit B/cssB protein, expressed by E. coli , with N-His, N-SUMO labeled tag. The total length of CS6 fimbrial subunit B/cssB Protein, E.coli (His-SUMO) is 146 a.a., with molecular weight of ~31.9 kDa.

CS6 fimbrial subunit B (cssB) is a component of E.coli CS6 operon. CssB is a structural subunit which binds to cell surface sulfatide and is a key factor for binding to host cells. CssA can inhibit the CssB-mediated binding as another structural subunit of CS6. CssB is also required for stabilization of CssA, while all css genes are necessary for maximal adhesion of E.coli to epithelial cells and CS6 assembly^[1].

E.coli

E. coli

N-His;N-SUMO

P53510 (22G-167N)

/

GNWQYKSLDVNVNIEQNFIPDIDSAVRIIPVNYDSDPKLNSQLYTVEMTIPAGVSAVKIVPTDSLTSSGQQIGKLVNVNNPDQNMNYYIRKDSGAGKFMAGQKGSFSVKENTSYTFSAIYTGGEYPNSGYSSGTYAGHLTVSFYSN

Approximately 31.9 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.