1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. GM-CSF
  5. GM-CSF Protein, Bovine (P. pastoris, His-Myc)

GM-CSF Protein, Bovine (P. pastoris, His-Myc)

Cat. No.: HY-P700512
COA Handling Instructions

The GM-CSF protein is a key cytokine that fundamentally stimulates the growth and differentiation of hematopoietic precursor cells, including granulocytes, macrophages, eosinophils, and erythrocytes. As a monomer, GM-CSF interacts with the GM-CSF receptor complex to form a dodecamer, which contains two α, two β, and two head-to-head hexamers of the ligand subunits. GM-CSF Protein, Bovine (P. pastoris, His-Myc) is the recombinant bovine-derived GM-CSF protein, expressed by P. pastoris , with C-Myc, C-6*His labeled tag. The total length of GM-CSF Protein, Bovine (P. pastoris, His-Myc) is 126 a.a., with molecular weight of 18 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
20 μg $295 In-stock
50 μg $560 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The GM-CSF protein is a key cytokine that fundamentally stimulates the growth and differentiation of hematopoietic precursor cells, including granulocytes, macrophages, eosinophils, and erythrocytes. As a monomer, GM-CSF interacts with the GM-CSF receptor complex to form a dodecamer, which contains two α, two β, and two head-to-head hexamers of the ligand subunits. GM-CSF Protein, Bovine (P. pastoris, His-Myc) is the recombinant bovine-derived GM-CSF protein, expressed by P. pastoris , with C-Myc, C-6*His labeled tag. The total length of GM-CSF Protein, Bovine (P. pastoris, His-Myc) is 126 a.a., with molecular weight of 18 kDa.

Background

The GM-CSF Protein, a pivotal cytokine, plays a fundamental role in stimulating the growth and differentiation of hematopoietic precursor cells from diverse lineages, encompassing granulocytes, macrophages, eosinophils, and erythrocytes. Existing as a monomer, GM-CSF exerts its biological effects through the GM-CSF receptor complex, which forms a dodecamer comprising two head-to-head hexamers of two alpha, two beta, and two ligand subunits. This intricate receptor complex underscores the multi-faceted nature of GM-CSF in orchestrating cellular responses critical for hematopoiesis and immune function.

Species

Bovine

Source

P. pastoris

Tag

C-Myc;C-6*His

Accession

P11052 (A18-K143)

Gene ID

281095  [NCBI]

Molecular Construction
N-term
GM-CSF (A18-K143)
Accession # P11052
6*His-Myc
C-term
Synonyms
colony stimulating factor 2 (granulocyte-macrophage); GMCSF; MGC131935; MGC138897; granulocyte-macrophage colony-stimulating factor; CSF; molgramostin; sargramostim; colony-stimulating factor; granulocyte-macrophage colony stimulating factor
AA Sequence

APTRPPNTATRPWQHVDAIKEALSLLNHSSDTDAVMNDTEVVSEKFDSQEPTCLQTRLKLYKNGLQGSLTSLMGSLTMMATHYEKHCPPTPETSCGTQFISFKNFKEDLKEFLFIIPFDCWEPAQK

Molecular Weight

18 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GM-CSF Protein, Bovine (P. pastoris, His-Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GM-CSF Protein, Bovine (P. pastoris, His-Myc)
Cat. No.:
HY-P700512
Quantity:
MCE Japan Authorized Agent: