Copy Link Print Information

GM-CSF Protein, Bovine (P. pastoris, His-Myc)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

The GM-CSF protein is a key cytokine that fundamentally stimulates the growth and differentiation of hematopoietic precursor cells, including granulocytes, macrophages, eosinophils, and erythrocytes. As a monomer, GM-CSF interacts with the GM-CSF receptor complex to form a dodecamer, which contains two α, two β, and two head-to-head hexamers of the ligand subunits. GM-CSF Protein, Bovine (P. pastoris, His-Myc) is the recombinant bovine-derived GM-CSF protein, expressed by P. pastoris , with C-Myc, C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Bovine
  • Source: P. pastoris
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • GM-CSF Protein, Bovine (P. pastoris, His-Myc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The GM-CSF protein is a key cytokine that fundamentally stimulates the growth and differentiation of hematopoietic precursor cells, including granulocytes, macrophages, eosinophils, and erythrocytes. As a monomer, GM-CSF interacts with the GM-CSF receptor complex to form a dodecamer, which contains two α, two β, and two head-to-head hexamers of the ligand subunits. GM-CSF Protein, Bovine (P. pastoris, His-Myc) is the recombinant bovine-derived GM-CSF protein, expressed by P. pastoris , with C-Myc, C-6*His labeled tag.

Background

The GM-CSF Protein, a pivotal cytokine, plays a fundamental role in stimulating the growth and differentiation of hematopoietic precursor cells from diverse lineages, encompassing granulocytes, macrophages, eosinophils, and erythrocytes. Existing as a monomer, GM-CSF exerts its biological effects through the GM-CSF receptor complex, which forms a dodecamer comprising two head-to-head hexamers of two alpha, two beta, and two ligand subunits. This intricate receptor complex underscores the multi-faceted nature of GM-CSF in orchestrating cellular responses critical for hematopoiesis and immune function.

Technical Parameters

  • Species Bovine
  • Source P. pastoris
  • Tag C-Myc;C-6*His
  • Accession

    P11052 (A18-K143)

  • Gene ID
    281095  [NCBI]
  • Molecular Construction
    • N-term
    • GM-CSF (A18-K143)
      Accession # P11052
    • 6*His-Myc
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CSF2; Molgramostim; Colony Stimulating Factor 2; Molgramostin; GMCSF; CSF; Sargramostim; Granulocyte-Macrophage Colony Stimulating Factor; GM-CSF; Granulocyte Macrophage-Colony Stimulating Factor; Colony Stimulating Factor 2 (Granulocyte-Macrophage); Colo

  • AA Sequence

    APTRPPNTATRPWQHVDAIKEALSLLNHSSDTDAVMNDTEVVSEKFDSQEPTCLQTRLKLYKNGLQGSLTSLMGSLTMMATHYEKHCPPTPETSCGTQFISFKNFKEDLKEFLFIIPFDCWEPAQK

  • Predicted Molecular Mass

    18 kDa

  • Molecular Weight

    Approximately 21-24 kDa, based on SDS-PAGE under reducing condition, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0 .
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
2.Lyophilized from a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • GM-CSF Protein, Bovine (P. pastoris, His-Myc) Product Image
    1/16
  • GM-CSF Protein, Bovine (P. pastoris, His-Myc) Product Image