1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Neurotrophic Factors
  4. Cardiotrophin-1
  5. Cardiotrophin-1/CTF1 Protein, Mouse (HEK293)

Cardiotrophin-1/CTF1 Protein, Mouse (HEK293, His), a member of IL-6 family of cytokines, is required for cardiac myocyte maturation and plays an important role in the differentiation, development, and survival of neural stem cells.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고
10 μg Ask For Quote & Lead Time
50 μg Ask For Quote & Lead Time

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

Cardiotrophin-1/CTF1 Protein, Mouse (HEK293, His), a member of IL-6 family of cytokines, is required for cardiac myocyte maturation and plays an important role in the differentiation, development, and survival of neural stem cells.

Background

Cardiotrophin-1 (CT-1) is required for cardiac myocyte maturation and is capable of promoting cell survival in neonatal rat cardiomyocytes subjected to serum deprivation through an antiapoptotic pathway mediated by MAPK, ERK1/2CT1[1]. CT-1 exhibits impressive neuroprotective effects and delay the procession of motor neuron degenerative disorders by prolonging the median neuronal survival time, improving motor function and promoting regeneration in neonatal rat motor neurons in mouse models of amyotrophic lateral sclerosis, progressive motor neuropathy and spinal muscular atrophy and in adult rats with spinal cord injuries[2].

Species

Mouse

Source

HEK293

Tag

Tag Free

Accession

Q60753 (S2-A203)

Gene ID
Molecular Construction
N-term
CTF1 (S2-A203)
Accession # Q60753
C-term
Protein Length

Partial

Synonyms
rMuCT-1; CTF1
AA Sequence

SQREGSLEDHQTDSSISFLPHLEAKIRQTHNLARLLTKYAEQLLEEYVQQQGEPFGLPGFSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSVLPALLDAVRRRQAELNPRAPRLLRSLEDAARQVRALGAAVETVLAALGAAARGPGPEPVTVATLFTANSTAGIFSAKVLGFHVCGLYGEWVSRTEGDLGQLVPGGVA

분자량

22-27 kDa

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Endotoxin Level

<0.2 EU/μg, determined by LAL method.

각종 서류
References

Cardiotrophin-1/CTF1 Protein, Mouse (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Cardiotrophin-1/CTF1 Protein, Mouse (HEK293)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Cardiotrophin-1/CTF1 Protein, Mouse (HEK293)
Cat. No.:
HY-P7150
수량:
MCE Japan Authorized Agent: