Cardiotrophin-1/CTF1 Protein, Mouse (HEK293)

Cardiotrophin-1/CTF1 Protein, Mouse (HEK293, His), a member of IL-6 family of cytokines, is required for cardiac myocyte maturation and plays an important role in the differentiation, development, and survival of neural stem cells.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

Cardiotrophin-1/CTF1 Protein, Mouse (HEK293, His), a member of IL-6 family of cytokines, is required for cardiac myocyte maturation and plays an important role in the differentiation, development, and survival of neural stem cells.

Background

Cardiotrophin-1 (CT-1) is required for cardiac myocyte maturation and is capable of promoting cell survival in neonatal rat cardiomyocytes subjected to serum deprivation through an antiapoptotic pathway mediated by MAPK, ERK1/2CT1[1]. CT-1 exhibits impressive neuroprotective effects and delay the procession of motor neuron degenerative disorders by prolonging the median neuronal survival time, improving motor function and promoting regeneration in neonatal rat motor neurons in mouse models of amyotrophic lateral sclerosis, progressive motor neuropathy and spinal muscular atrophy and in adult rats with spinal cord injuries[2].

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CTF1 (S2-A203)
      Accession # Q60753
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    CTF1; CT1; Cardiotrophin 1; Cardiotrophin-1; CT-1; Cardiophin 1

  • AA Sequence

    SQREGSLEDHQTDSSISFLPHLEAKIRQTHNLARLLTKYAEQLLEEYVQQQGEPFGLPGFSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSVLPALLDAVRRRQAELNPRAPRLLRSLEDAARQVRALGAAVETVLAALGAAARGPGPEPVTVATLFTANSTAGIFSAKVLGFHVCGLYGEWVSRTEGDLGQLVPGGVA

  • Molecular Weight

    Approximately 22-27 kDa, based on SDS-PAGE under non reducing (N) conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00