1. Recombinant Proteins
  2. CT-1 Protein, Mouse (HEK293, His)

CT-1 Protein, Mouse (HEK293, His)

Cat. No.: HY-P7150
Handling Instructions

CT-1 Protein, Mouse (HEK293, His), a member of IL-6 family of cytokines, is required for cardiac myocyte maturation and plays an important role in the differentiation, development, and survival of neural stem cells.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $660 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rMuCT-1; CTF1
Species

Mouse

Source

HEK 293

Accession

Q60753 (S2-A203)

Gene ID

13019

Molecular Weight

22-27 kDa

AA Sequence

SQREGSLEDHQTDSSISFLPHLEAKIRQTHNLARLLTKYAEQLLEEYVQQQGEPFGLPGFSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSVLPALLDAVRRRQAELNPRAPRLLRSLEDAARQVRALGAAVETVLAALGAAARGPGPEPVTVATLFTANSTAGIFSAKVLGFHVCGLYGEWVSRTEGDLGQLVPGGVA

Biological Activity
The ED50 is <1.25 ng/mL as measured by TF-1 cells, corresponding to a specific activity of >0.8 × 106 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Cardiotrophin-1 (CT-1) is required for cardiac myocyte maturation and is capable of promoting cell survival in neonatal rat cardiomyocytes subjected to serum deprivation through an antiapoptotic pathway mediated by MAPK, ERK1/2CT1[1]. CT-1 exhibits impressive neuroprotective effects and delay the procession of motor neuron degenerative disorders by prolonging the median neuronal survival time, improving motor function and promoting regeneration in neonatal rat motor neurons in mouse models of amyotrophic lateral sclerosis, progressive motor neuropathy and spinal muscular atrophy and in adult rats with spinal cord injuries[2].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CT-1 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P7150
Quantity:
MCE Japan Authorized Agent: