CT83 Protein, Human (His, B2M)
Based on 1 Customer Validation
The CT83 protein shows specific expression in the testis, highlighting its selective presence in this reproductive organ. In addition, multiple cancer cell lines express CT83, suggesting a potential association with malignancy. CT83 Protein, Human (His, B2M) is the recombinant human-derived CT83 protein, expressed by E. coli , with N-His, B2M labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The CT83 protein shows specific expression in the testis, highlighting its selective presence in this reproductive organ. In addition, multiple cancer cell lines express CT83, suggesting a potential association with malignancy. CT83 Protein, Human (His, B2M) is the recombinant human-derived CT83 protein, expressed by E. coli , with N-His, B2M labeled tag.
CT83 protein exhibits specific expression in the testis, emphasizing its selective presence within this reproductive organ. Additionally, it is expressed by various cancer cell lines, suggesting a potential association with malignancies. The dual expression pattern of CT83 in both normal testicular tissues and cancer cells underscores its relevance in contexts ranging from normal physiological functions to pathological conditions. This distinctive expression profile hints at a potential role for CT83 in reproductive processes and implicates its involvement in cancer-related mechanisms. The dual expression in testicular and cancerous contexts highlights the versatility of CT83 and underscores its significance in both normal and disease-associated cellular contexts.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His;B2M
-
Accession
Q5H943 (M1-T113)
-
Molecular Construction
-
N-term
-
6*His-B2M
-
CT83 (M1-T113)
Accession # Q5H943 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
CT83; FLJ20611; Prev. CXorf61; KKLC1; KK-LC-1; Chromosome X Open Reading Frame 61; Kita-Kyushu Lung Cancer Antigen 1; Cancer/Testis Antigen 83; FLJ22913
-
AA Sequence
MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
-
Predicted Molecular Mass
26.8 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
