CT83 Protein, Human (His, B2M)

The CT83 protein shows specific expression in the testis, highlighting its selective presence in this reproductive organ. In addition, multiple cancer cell lines express CT83, suggesting a potential association with malignancy. CT83 Protein, Human (His, B2M) is the recombinant human-derived CT83 protein, expressed by E. coli , with N-His, B2M labeled tag. The total length of CT83 Protein, Human (His, B2M) is 113 a.a., with molecular weight of ~26.8 kDa.

CT83 protein exhibits specific expression in the testis, emphasizing its selective presence within this reproductive organ. Additionally, it is expressed by various cancer cell lines, suggesting a potential association with malignancies. The dual expression pattern of CT83 in both normal testicular tissues and cancer cells underscores its relevance in contexts ranging from normal physiological functions to pathological conditions. This distinctive expression profile hints at a potential role for CT83 in reproductive processes and implicates its involvement in cancer-related mechanisms. The dual expression in testicular and cancerous contexts highlights the versatility of CT83 and underscores its significance in both normal and disease-associated cellular contexts.

Human

E. coli

N-His;B2M

Q5H943 (1M-113T)

203413  [NCBI]

MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST

Approximately 26.8 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in Tris-based buffer, 50% glycerol.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.