Copy Link Print Information

CCN2/CTGF Protein, Human (HEK293)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

CCN2/CTGF (Connective Tissue Growth Factor) is a protein produced primarily by endothelial cells in blood vessels. It plays an important role in various cellular processes. CCN2/CTGF Protein, Human (HEK293) is the recombinant human-derived CCN2/CTGF protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for CCN2/CTGF Protein, Human (HEK293)
  • Experimental Validation Results for CCN2/CTGF Protein, Human (HEK293)
  • CCN2/CTGF Protein, Human (HEK293) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CCN2/CTGF (Connective Tissue Growth Factor) is a protein produced primarily by endothelial cells in blood vessels. It plays an important role in various cellular processes. CCN2/CTGF Protein, Human (HEK293) is the recombinant human-derived CCN2/CTGF protein, expressed by HEK293 , with tag free.

Background

CCN2/CTGF (Connective Tissue Growth Factor) is a protein primarily produced by vascular endothelial cells. It plays a significant role in various cellular processes. One of its main functions is to attract and stimulate the proliferation and differentiation of chondrocytes, which are cells involved in the formation of cartilage. Additionally, CCN2/CTGF mediates cell adhesion in various cell types, including fibroblasts, myofibroblasts, endothelial cells, and epithelial cells. This adhesion is dependent on the presence of heparin (a polysaccharide) and divalent cations (such as calcium or magnesium). Furthermore, CCN2/CTGF enhances the DNA synthesis induced by fibroblast growth factors, which are proteins involved in cell growth and repair. Overall, CCN2/CTGF is an important protein that regulates cellular processes such as chondrocyte function, cell adhesion, and DNA synthesis, contributing to the development and maintenance of connective tissues.

Verified Bioactivity

Measured by its ability to mediate Balb/3T3 mouse embryonic fibroblast cell adhesion.The ED50 this effect is 0.5-1.5 μg/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag Tag Free
  • Accession

    Q5M8T4 (Q27-A180)

  • Gene ID
    1490  [NCBI]
  • Molecular Construction
    • N-term
    • CTGF (Q27-A180)
      Accession # Q5M8T4
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CCN2; CCN Family Member 2; Prev. CTGF; IBP-8; IGFBP8; SEMDLSL; Connective Tissue Growth Factor; IGFBP-8; Hypertrophic Chondrocyte-Specific Protein 24; NOV2; Insulin-Like Growth Factor-Binding Protein 8; KMD; IGF-Binding Protein 8; Cellular Communication N

  • AA Sequence

    QNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALA

  • Predicted Molecular Mass

    16.3 kDa

  • Molecular Weight

    Approximately 16-25 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to mediate Balb/3T3 mouse embryonic fibroblast cell adhesion.The ED50 this effect is 0.8781 μg/mL, corresponding to a specific activity is 1.139×103 units/mg.

  • CCN2/CTGF Protein, Human (HEK293) Product Image
    1/16
  • Experimental Validation Results for CCN2/CTGF Protein, Human (HEK293)
  • Experimental Validation Results for CCN2/CTGF Protein, Human (HEK293)
  • CCN2/CTGF Protein, Human (HEK293) Product Image