Cyclin A1 Protein, Human (sf9, His)

Cyclin A1 protein is a key regulator in the cell cycle, affecting G1/S and G2/M transitions and playing a major role in the germline meiotic cell cycle. It interacts with CDK2 and CDC2 kinase to form a holoenzyme complex that participates in the regulatory pathways of E2F-1 and RB proteins. Cyclin A1 Protein, Human (sf9, His) is the recombinant human-derived Cyclin A1 protein, expressed by Sf9 insect cells , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Cyclin A1 protein is a key regulator in the cell cycle, affecting G1/S and G2/M transitions and playing a major role in the germline meiotic cell cycle. It interacts with CDK2 and CDC2 kinase to form a holoenzyme complex that participates in the regulatory pathways of E2F-1 and RB proteins. Cyclin A1 Protein, Human (sf9, His) is the recombinant human-derived Cyclin A1 protein, expressed by Sf9 insect cells , with N-His labeled tag.

Background

Cyclin A1 Protein emerges as a pivotal regulator in the intricate control of the cell cycle, exerting influence at the G1/S (start) and G2/M (mitosis) transitions. Its role extends beyond somatic cells, as it appears to be primarily involved in governing the germline meiotic cell cycle, with additional functions in the mitotic cell cycle of certain somatic cells. Through interactions with CDK2 and CDC2 protein kinases, Cyclin A1 forms a serine/threonine kinase holoenzyme complex, where the cyclin subunit confers substrate specificity. Notably, it does not bind CDK4 and CDK5 in vitro. The Cyclin A1-CDK2 complex interacts with transcription factor E2F-1 and RB proteins, underscoring its involvement in crucial regulatory pathways. Furthermore, it participates in complexes with CDK2, CABLES1, and CCNE1, indicating its multifaceted interactions within the cell cycle regulatory network. Interactions with INCA1 and KLHDC9 further highlight the intricate molecular associations that contribute to Cyclin A1's role in cell cycle regulation. Unraveling the specific mechanisms governing Cyclin A1's interactions and functions could provide valuable insights into its regulatory impact on both meiotic and mitotic cell cycles.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • Cyclin A1 (M1-Q465)
      Accession # P78396
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    CCNA1; Cyclin-A1; Cyclin A1; Testicular Tissue Protein Li 34; CT146

  • AA Sequence

    METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQQPVESEAMHCSNPKSGVVLATVARGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKKALPDCGVQEPPKQGFDIYMDELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFNTVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKYEEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIVPCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLLQ

  • Predicted Molecular Mass

    54.6 kDa

  • Molecular Weight

    Approximately 50 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00