Cyclin A1 Protein, Human (SF9, His)

Cyclin A1 protein is a key regulator in the cell cycle, affecting G1/S and G2/M transitions and playing a major role in the germline meiotic cell cycle. It interacts with CDK2 and CDC2 kinase to form a holoenzyme complex that participates in the regulatory pathways of E2F-1 and RB proteins. Cyclin A1 Protein, Human (SF9, His) is the recombinant human-derived Cyclin A1 protein, expressed by Sf9 insect cells , with N-His labeled tag. The total length of Cyclin A1 Protein, Human (SF9, His) is 465 a.a., with molecular weight of ~50 kDa.

Cyclin A1 Protein emerges as a pivotal regulator in the intricate control of the cell cycle, exerting influence at the G1/S (start) and G2/M (mitosis) transitions. Its role extends beyond somatic cells, as it appears to be primarily involved in governing the germline meiotic cell cycle, with additional functions in the mitotic cell cycle of certain somatic cells. Through interactions with CDK2 and CDC2 protein kinases, Cyclin A1 forms a serine/threonine kinase holoenzyme complex, where the cyclin subunit confers substrate specificity. Notably, it does not bind CDK4 and CDK5 in vitro. The Cyclin A1-CDK2 complex interacts with transcription factor E2F-1 and RB proteins, underscoring its involvement in crucial regulatory pathways. Furthermore, it participates in complexes with CDK2, CABLES1, and CCNE1, indicating its multifaceted interactions within the cell cycle regulatory network. Interactions with INCA1 and KLHDC9 further highlight the intricate molecular associations that contribute to Cyclin A1's role in cell cycle regulation. Unraveling the specific mechanisms governing Cyclin A1's interactions and functions could provide valuable insights into its regulatory impact on both meiotic and mitotic cell cycles.

Human

Sf9 insect cells

N-His

P78396 (M1-Q465)

8900  [NCBI]

METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQQPVESEAMHCSNPKSGVVLATVARGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKKALPDCGVQEPPKQGFDIYMDELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFNTVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKYEEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIVPCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLLQ

Approximately 50 kDa

Greater than 95% as determined by reducing SDS-PAGE

<1 EU/μg, determined by LAL method.