CYP11B2 Protein, Human (His-SUMO)
Based on 1 Customer Validation
CYP11B2 Protein, a cytochrome P450 monooxygenase, synthesizes aldosterone, pivotal for salt and water balance, impacting blood pressure and cardiovascular health. Mechanistically, it orchestrates three oxidative reactions, forming aldosterone, utilizing molecular oxygen and a mitochondrial transfer system. Additionally, CYP11B2 may be involved in the androgen metabolic pathway, expanding its physiological roles. CYP11B2 Protein, Human (His-SUMO) is the recombinant human-derived CYP11B2 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CYP11B2 Protein, a cytochrome P450 monooxygenase, synthesizes aldosterone, pivotal for salt and water balance, impacting blood pressure and cardiovascular health. Mechanistically, it orchestrates three oxidative reactions, forming aldosterone, utilizing molecular oxygen and a mitochondrial transfer system. Additionally, CYP11B2 may be involved in the androgen metabolic pathway, expanding its physiological roles. CYP11B2 Protein, Human (His-SUMO) is the recombinant human-derived CYP11B2 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
Background
The CYP11B2 protein, a cytochrome P450 monooxygenase, plays a crucial role in catalyzing the biosynthesis of aldosterone, the primary mineralocorticoid responsible for maintaining salt and water homeostasis in the human body. Its involvement in blood pressure regulation, arterial hypertension, and heart failure underscores its significance in cardiovascular health. Mechanistically, CYP11B2 orchestrates three sequential oxidative reactions of 11-deoxycorticosterone, involving 11-beta hydroxylation and two successive oxidations at C18, ultimately resulting in the formation of aldosterone. The enzyme utilizes molecular oxygen to insert one oxygen atom into the substrate, with the second oxygen atom reduced into a water molecule. This process is facilitated by a two-protein mitochondrial transfer system comprising flavoprotein FDXR (adrenodoxin/ferredoxin reductase) and nonheme iron-sulfur proteins FDX1 or FDX2 (adrenodoxin/ferredoxin), with two electrons supplied by NADPH. Additionally, CYP11B2 may be implicated in the androgen metabolic pathway, offering further insights into its diverse physiological roles.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His;N-SUMO
-
Accession
P19099 (G25-N503)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
CYP11B2 (G25-N503)
Accession # P19099 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CYP11B2; Cytochrome P450 11B2, Mitochondrial; Prev. CYP11B; Steroid 11-Beta-Monooxygenase; ALDOS; Steroid 18-Hydroxylase; P-450C18; Aldosterone Synthase; P450aldo; Cytochrome P-450Aldo; CYP11BL; Cytochrome P-450C18; CPN2; CYPXIB2; Cytochrome P450, Subfami
-
AA Sequence
GTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN
-
Predicted Molecular Mass
71 kDa
-
Molecular Weight
Approximately 66 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)