1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. CYP11B2 Protein, Human (His-SUMO)

CYP11B2 Protein, Human (His-SUMO)

Cat. No.: HY-P72163
SDS COA Handling Instructions

CYP11B2 Protein, a cytochrome P450 monooxygenase, synthesizes aldosterone, pivotal for salt and water balance, impacting blood pressure and cardiovascular health. Mechanistically, it orchestrates three oxidative reactions, forming aldosterone, utilizing molecular oxygen and a mitochondrial transfer system. Additionally, CYP11B2 may be involved in the androgen metabolic pathway, expanding its physiological roles. CYP11B2 Protein, Human (His-SUMO) is the recombinant human-derived CYP11B2 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag. The total length of CYP11B2 Protein, Human (His-SUMO) is 479 a.a., with molecular weight (affected by relative charge) of 66 KDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $88 In-stock
10 μg $150 In-stock
50 μg $420 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CYP11B2 Protein, a cytochrome P450 monooxygenase, synthesizes aldosterone, pivotal for salt and water balance, impacting blood pressure and cardiovascular health. Mechanistically, it orchestrates three oxidative reactions, forming aldosterone, utilizing molecular oxygen and a mitochondrial transfer system. Additionally, CYP11B2 may be involved in the androgen metabolic pathway, expanding its physiological roles. CYP11B2 Protein, Human (His-SUMO) is the recombinant human-derived CYP11B2 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag. The total length of CYP11B2 Protein, Human (His-SUMO) is 479 a.a., with molecular weight (affected by relative charge) of 66 KDa.

Background

The CYP11B2 protein, a cytochrome P450 monooxygenase, plays a crucial role in catalyzing the biosynthesis of aldosterone, the primary mineralocorticoid responsible for maintaining salt and water homeostasis in the human body. Its involvement in blood pressure regulation, arterial hypertension, and heart failure underscores its significance in cardiovascular health. Mechanistically, CYP11B2 orchestrates three sequential oxidative reactions of 11-deoxycorticosterone, involving 11-beta hydroxylation and two successive oxidations at C18, ultimately resulting in the formation of aldosterone. The enzyme utilizes molecular oxygen to insert one oxygen atom into the substrate, with the second oxygen atom reduced into a water molecule. This process is facilitated by a two-protein mitochondrial transfer system comprising flavoprotein FDXR (adrenodoxin/ferredoxin reductase) and nonheme iron-sulfur proteins FDX1 or FDX2 (adrenodoxin/ferredoxin), with two electrons supplied by NADPH. Additionally, CYP11B2 may be implicated in the androgen metabolic pathway, offering further insights into its diverse physiological roles.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-6*His;N-SUMO

Accession

P19099 (G25-N503)

Gene ID
Molecular Construction
N-term
6*His-SUMO
CYP11B2 (G25-N503)
Accession # P19099
C-term
Synonyms
ALDOS; Aldosterone synthase; Aldosterone-synthesizing enzyme; C11B2_HUMAN; CYP11B2; CYPXIB2; Cytochrome P-450Aldo; Cytochrome P-450C18; Cytochrome P450 11B2; Cytochrome P450 11B2; mitochondrial; mitochondrial; P-450Aldo; P-450C18; Steroid 18-hydroxylase
AA Sequence

GTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN

Molecular Weight

66 kDa.The reducing(R)protein migrates as 66 kDa in SDS-PAGE may be due to relative charge.

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

CYP11B2 Protein, Human (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CYP11B2 Protein, Human (His-SUMO)
Cat. No.:
HY-P72163
Quantity:
MCE Japan Authorized Agent: