Cystatin C/CST3 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

Cystatin C (CST3), an inhibitor of cysteine proteinases, acts as a local regulator, playing a vital role in modulating proteolytic processes by inhibiting cysteine proteinases within specific cellular environments. Cystatin C/CST3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Cystatin C/CST3 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Cystatin C (CST3), an inhibitor of cysteine proteinases, acts as a local regulator, playing a vital role in modulating proteolytic processes by inhibiting cysteine proteinases within specific cellular environments. Cystatin C/CST3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Cystatin C/CST3 protein, expressed by HEK293 , with C-His labeled tag.

Background

Cystatin C (CST3), functioning as an inhibitor of cysteine proteinases, is believed to play a crucial physiological role as a local regulator of this enzyme activity. Its inhibitory function contributes to the regulation of cysteine proteinases, suggesting a role in modulating proteolytic processes within specific cellular environments.

Verified Bioactivity

Measured by its ability to inhibit papain cleavage of a fluorogenic peptide substrate Z-FR-AMC and the IC50 value is < 25 nM. (Activation description: Papain needs to be activated in activation buffer for an activated form.)

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CST3 (M1-A140)
      Accession # P21460
    • 10*His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    CST3; Cystatin C (Amyloid Angiopathy And Cerebral Hemorrhage); Cystatin C; BA218C14.4 (Cystatin C); Epididymis Secretory Protein Li 2; Cystatin 3; Neuroendocrine Basic Polypeptide; Cystatin-3; Post-Gamma-Globulin; HEL-S-2; Gamma-Trace; ADLDWA; Cystatin-C;

  • AA Sequence

    ATPKQGPRMLGAPEEADANEEGVRRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGVNYFLDVEMGRTTCTKSQTNLTDCPFHDQPHLMRKALCSFQIYSVPWKGTHSLTKFSCKNA

  • Predicted Molecular Mass

    15 kDa

  • Molecular Weight

    Approximately 15 kDa & 18 kDa & 21-24 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM HEPES, 150 mM NaCl, pH 7.0, 5% trehalose, 5% mannitol and 0.01% Tween 80.
2. Lyophilized from a 0.22 μm filtered solution of 20 mM HEPES, 150 mM NaCl, pH 7.0, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00