Cystatin C/CST3 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
Cystatin C (CST3), an inhibitor of cysteine proteinases, acts as a local regulator, playing a vital role in modulating proteolytic processes by inhibiting cysteine proteinases within specific cellular environments. Cystatin C/CST3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Cystatin C/CST3 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Cystatin C (CST3), an inhibitor of cysteine proteinases, acts as a local regulator, playing a vital role in modulating proteolytic processes by inhibiting cysteine proteinases within specific cellular environments. Cystatin C/CST3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Cystatin C/CST3 protein, expressed by HEK293 , with C-His labeled tag.
Background
Cystatin C (CST3), functioning as an inhibitor of cysteine proteinases, is believed to play a crucial physiological role as a local regulator of this enzyme activity. Its inhibitory function contributes to the regulation of cysteine proteinases, suggesting a role in modulating proteolytic processes within specific cellular environments.
Verified Bioactivity
Measured by its ability to inhibit papain cleavage of a fluorogenic peptide substrate Z-FR-AMC and the IC50 value is < 25 nM. (Activation description: Papain needs to be activated in activation buffer for an activated form.)
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-10*His
-
Accession
P21460 (A21-A140)
-
Molecular Construction
-
N-term
-
CST3 (M1-A140)
Accession # P21460 -
10*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
CST3; Cystatin C (Amyloid Angiopathy And Cerebral Hemorrhage); Cystatin C; BA218C14.4 (Cystatin C); Epididymis Secretory Protein Li 2; Cystatin 3; Neuroendocrine Basic Polypeptide; Cystatin-3; Post-Gamma-Globulin; HEL-S-2; Gamma-Trace; ADLDWA; Cystatin-C;
-
AA Sequence
ATPKQGPRMLGAPEEADANEEGVRRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGVNYFLDVEMGRTTCTKSQTNLTDCPFHDQPHLMRKALCSFQIYSVPWKGTHSLTKFSCKNA
-
Predicted Molecular Mass
15 kDa
-
Molecular Weight
Approximately 15 kDa & 18 kDa & 21-24 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 20 mM HEPES, 150 mM NaCl, pH 7.0, 5% trehalose, 5% mannitol and 0.01% Tween 80.
2. Lyophilized from a 0.22 μm filtered solution of 20 mM HEPES, 150 mM NaCl, pH 7.0, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
