Cystatin C/CST3 Protein, Mouse (HEK293, His)

Cystatin C (CST3), an inhibitor of cysteine proteinases, acts as a local regulator, playing a vital role in modulating proteolytic processes by inhibiting cysteine proteinases within specific cellular environments. Cystatin C/CST3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Cystatin C/CST3 protein, expressed by HEK293 , with C-His labeled tag. The total length of Cystatin C/CST3 Protein, Mouse (HEK293, His) is 140 a.a., with molecular weight of ~15 & 18 & 21-24 kDa, respectively.

Cystatin C (CST3), functioning as an inhibitor of cysteine proteinases, is believed to play a crucial physiological role as a local regulator of this enzyme activity. Its inhibitory function contributes to the regulation of cysteine proteinases, suggesting a role in modulating proteolytic processes within specific cellular environments.

Measured by its ability to inhibit papain cleavage of a fluorogenic peptide substrate Z-FR-AMC and the IC₅₀ value is < 25 nM.

Mouse

HEK293

C-His

P21460 (M1-A140)

13010  [NCBI]

MASPLRSLLFLLAVLAVAWAATPKQGPRMLGAPEEADANEEGVRRALDFAVSEYNKGSNDAYHSRAIQVVRARKQLVAGVNYFLDVEMGRTTCTKSQTNLTDCPFHDQPHLMRKALCSFQIYSVPWKGTHSLTKFSCKNA

Approximately 15&18&21-24 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM HEPES, 150 mM NaCl, pH 7.0. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.