Cytochrome c/CYCS Protein, Human (His)
Based on 2 publication(s) in Google Scholar
Cytochrome c/CYCS protein is a conserved heme-containing protein, and its core function is electron transport. Cytochrome c is widely involved in physiological processes such as aerobic/anaerobic respiration, apoptosis, and antioxidation. Cytochrome c/CYCS Protein, Human (His) is the recombinant Cytochrome c/CYCS protein expressed by E. coli and carries a C-terminal 6*His tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
Cytochrome c/CYCS protein is a conserved heme-containing protein, and its core function is electron transport. Cytochrome c is widely involved in physiological processes such as aerobic/anaerobic respiration, apoptosis, and antioxidation. Cytochrome c/CYCS Protein, Human (His) is the recombinant Cytochrome c/CYCS protein expressed by E. coli and carries a C-terminal 6*His tag[1].
Background
Cytochrome c/CYCS protein, as a core component of the mitochondrial electron transport chain, is responsible for transferring electrons between cytochrome c reductase and oxidase, driving the oxidative phosphorylation process and ATP synthesis. In addition to its role in electron transport, Cytochrome c also plays a significant role in apoptosis. Upon stimulation by apoptotic signals, Cytochrome c is released from the mitochondrial intermembrane space into the cytoplasm, where it binds to APAF-1 to form an apoptosome, initiating the caspase cascade and inducing apoptosis. Furthermore, Cytochrome c is involved in the regulation of reactive oxygen species (ROS) metabolism, maintaining intracellular redox balance through antioxidant mechanisms. As a central molecule linking mitochondrial energy metabolism and apoptosis, Cytochrome c plays a critical role in various physiological and pathological processes[1].
In Vitro
Cytochrome c (10-20 μM; 0-150 min) can induce apoptosis in multiple cell types, such as normal rat renal epithelial cells, adrenocortical Y-1 tumor cells, mouse embryonic Swiss 3T3 fibroblasts, and IPC-81 leukemia cells[2].
Cytochrome c (5 μM; 3 min-15 h) increases K+ currents, and induces apoptosis and DNA fragmentation in rat pulmonary artery smooth muscle cells[3].
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
ACS Nano
Simultaneous Monitoring of Cytochrome c and Caspase-3 Dynamics Using a Dual-Channel Nanoprobe for Deciphering Single-Cell Apoptosis. [Abstract]2026 Apr 7;20(13):10605-10616. PMID: 41874337 -
Biophys Rep (N Y)
2025 Jul 25;5(3):100224. PMID: 40716612
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P99999 (G2-E105)
-
Molecular Construction
-
N-term
-
CYCS (G2-E105)
Accession # P99999 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
CYCS; Cytochrome C; Cytochrome C, Somatic; HCS; CYC; THC4
-
AA Sequence
GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
-
Predicted Molecular Mass
12.8 kDa
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM PB, 10% trehalose, 200 mM NaCl, 50% Glycerol, 0.05% Tween 80, pH 7.0.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (261 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Bertini I, et al. Cytochrome c: occurrence and functions. Chem Rev. 2006 Jan;106(1):90-115. [Content Brief]
[2]. Zhivotovsky B, et al. Injected cytochrome c induces apoptosis. Nature. 1998 Jan 29;391(6666):449-50. [Content Brief]
[3]. Platoshyn O, et al. Cytochrome c activates K+ channels before inducing apoptosis. Am J Physiol Cell Physiol. 2002 Oct;283(4):C1298-305. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)