Cytochrome c/CYCS Protein, Human (His)

Cytochrome c is an electron carrier protein that accepts electrons from cytochrome c1 and transfers them to the cytochrome oxidase complex in the mitochondrial electron transport chain. It is involved in apoptosis, where the release of cytochrome c into the cytosol leads to caspase-9 activation and subsequent acceleration of apoptosis. Cytochrome c/CYCS Protein, Human (His) is the recombinant human-derived Cytochrome c/CYCS protein, expressed by E. coli , with C-6*His labeled tag. The total length of Cytochrome c/CYCS Protein, Human (His) is 104 a.a., with molecular weight of ~16.0 kDa.

Cytochrome c/CYCS Protein functions as an essential electron carrier in cellular processes, particularly within the mitochondrial electron-transport chain. In its oxidized form, the cytochrome c heme group adeptly accepts an electron from the cytochrome c1 subunit of cytochrome reductase. Subsequently, this electron is transferred to the cytochrome oxidase complex, serving as the ultimate protein carrier in the mitochondrial electron-transport chain. Beyond its role in electron transport, cytochrome c plays a crucial part in apoptosis, wherein alterations in mitochondrial membrane permeability, induced by the suppression of anti-apoptotic members or activation of pro-apoptotic members of the Bcl-2 family, lead to the release of cytochrome c into the cytosol. The binding of cytochrome c to Apaf-1 triggers the activation of caspase-9, initiating a cascade that accelerates apoptosis by activating other caspases. This dual functionality underscores the versatile and pivotal role of Cytochrome c/CYCS Protein in both energy metabolism and the regulation of programmed cell death.

Human

E. coli

C-6*His

P99999 (G2-E105)

54205  [NCBI]

GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE

Approximately 16.0 kDa

Greater than 95% as determined by reducing SDS-PAGE

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM PB, 10% Trehalose, 200 mM NaCl, 50% Glycerol, 0.05% Tween 80, pH7.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.