Cytochrome c/CYCS Protein, Human (His)

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

Cytochrome c/CYCS protein is a conserved heme-containing protein, and its core function is electron transport. Cytochrome c is widely involved in physiological processes such as aerobic/anaerobic respiration, apoptosis, and antioxidation. Cytochrome c/CYCS Protein, Human (His) is the recombinant Cytochrome c/CYCS protein expressed by E. coli and carries a C-terminal 6*His tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

Cytochrome c/CYCS protein is a conserved heme-containing protein, and its core function is electron transport. Cytochrome c is widely involved in physiological processes such as aerobic/anaerobic respiration, apoptosis, and antioxidation. Cytochrome c/CYCS Protein, Human (His) is the recombinant Cytochrome c/CYCS protein expressed by E. coli and carries a C-terminal 6*His tag[1].

Background

Cytochrome c/CYCS protein, as a core component of the mitochondrial electron transport chain, is responsible for transferring electrons between cytochrome c reductase and oxidase, driving the oxidative phosphorylation process and ATP synthesis. In addition to its role in electron transport, Cytochrome c also plays a significant role in apoptosis. Upon stimulation by apoptotic signals, Cytochrome c is released from the mitochondrial intermembrane space into the cytoplasm, where it binds to APAF-1 to form an apoptosome, initiating the caspase cascade and inducing apoptosis. Furthermore, Cytochrome c is involved in the regulation of reactive oxygen species (ROS) metabolism, maintaining intracellular redox balance through antioxidant mechanisms. As a central molecule linking mitochondrial energy metabolism and apoptosis, Cytochrome c plays a critical role in various physiological and pathological processes[1].

In Vitro

Cytochrome c (10-20 μM; 0-150 min) can induce apoptosis in multiple cell types, such as normal rat renal epithelial cells, adrenocortical Y-1 tumor cells, mouse embryonic Swiss 3T3 fibroblasts, and IPC-81 leukemia cells[2].
Cytochrome c (5 μM; 3 min-15 h) increases K+ currents, and induces apoptosis and DNA fragmentation in rat pulmonary artery smooth muscle cells[3].

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CYCS (G2-E105)
      Accession # P99999
    • 6*His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    CYCS; Cytochrome C; Cytochrome C, Somatic; HCS; CYC; THC4

  • AA Sequence

    GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE

  • Predicted Molecular Mass

    12.8 kDa

  • Molecular Weight

    Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM PB, 10% trehalose, 200 mM NaCl, 50% Glycerol, 0.05% Tween 80, pH 7.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00