DAND1 Protein, Mouse (HEK293, His)

DAND1 protein, identified as a potential tumor suppressor gene in neuroblastoma, plays a pivotal role in inhibiting cells from progressing into the crucial G1/S stage of the transformation process. As a homodimer, DAND1 underscores its involvement in regulatory mechanisms governing cellular transformation and contributing to the maintenance of normal cellular growth control. DAND1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DAND1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of DAND1 Protein, Mouse (HEK293, His) is 162 a.a., with molecular weight of 25-28 kDa.

DAND1 protein emerges as a potential tumor suppressor gene in neuroblastoma, suggesting its pivotal role in impeding cells from progressing into the critical G1/S stage of the transformation process. Notably, DAND1 functions as a homodimer, underscoring its involvement in regulatory mechanisms that govern cellular transformation and potential contributions to the maintenance of normal cellular growth control.

Mouse

HEK293

C-6*His

Q61477 (A17-D178)

17965  [NCBI]

APPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKIVHCSCQACGKEPSHEGLNVYVQGEDSPGSQPGPHSHAHPHPGGQTPEPEEPPGAPQVEEEGAED

25-28 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.