Copy Link Print Information

DC-SIGN/CD209 Protein, Rhesus Macaque (HEK293, His)

Customer Review

Based on 1 Customer Validation

DC-SIGN/CD209 Protein, is a C-type lectin receptor present on the surface of both macrophages and dendritic cells (DCs), serves as a pivotal pathogen-recognition receptor, playing a crucial role in initiating the primary immune response. It mediates endocytosis and subsequent degradation of pathogens within lysosomal compartments. On DCs, it acts as a high-affinity receptor for ICAM2 and ICAM3, binding to mannose-like carbohydrates. DC-SIGN/CD209 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived DC-SIGN/CD209 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rhesus Macaque
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for DC-SIGN/CD209 Protein, Rhesus Macaque (HEK293, His)
  • Experimental Validation Results for DC-SIGN/CD209 Protein, Rhesus Macaque (HEK293, His)
  • DC-SIGN/CD209 Protein, Rhesus Macaque (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

DC-SIGN/CD209 Protein, is a C-type lectin receptor present on the surface of both macrophages and dendritic cells (DCs), serves as a pivotal pathogen-recognition receptor, playing a crucial role in initiating the primary immune response. It mediates endocytosis and subsequent degradation of pathogens within lysosomal compartments. On DCs, it acts as a high-affinity receptor for ICAM2 and ICAM3, binding to mannose-like carbohydrates. DC-SIGN/CD209 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived DC-SIGN/CD209 protein, expressed by HEK293 , with N-His labeled tag.

Background

DC-SIGN/CD209 protein, is a C-type lectin receptor present on the surface of both macrophages and dendritic cells (DCs), serves as a pivotal pathogen-recognition receptor, playing a crucial role in initiating the primary immune response. This receptor is implicated in the endocytosis of pathogens, leading to their subsequent degradation within lysosomal compartments. Following this process, DC-SIGN returns to the cell membrane surface, presenting pathogen-derived antigens to resting T-cells through MHC class II proteins, thereby triggering the adaptive immune response. On DCs, it acts as a high-affinity receptor for ICAM2 and ICAM3, binding to mannose-like carbohydrates. Notably, DC-SIGN may function as a DC rolling receptor, facilitating the transendothelial migration of DC precursors from the bloodstream to tissues by interacting with endothelial ICAM2. Furthermore, it appears to modulate DC-induced T-cell proliferation through its binding to ICAM3 on T-cells within the immunological synapse formed between DCs and T-cells[1][2].

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Recombinant Rhesus Macaque DC-SIGN at 2 μg/mL can bind gp120. The ED50 for this effect is 1.092 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Recombinant Rhesus Macaque DC-SIGN at 2 μg/mL canbind gp120. The ED50 for this effect is 1.092 μg/mL

Technical Parameters

  • Species Rhesus Macaque
  • Source HEK293
  • Tag N-6*His
  • Accession

    AAK74185.1 (K62-E381)

  • Gene ID
    574211  [NCBI]
  • Molecular Construction
    • N-term
    • His
    • CD209 (K62-E381)
      Accession # AAK74185.1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CD209; Dendritic Cell-Specific ICAM-3-Grabbing Non-Integrin 1; CD209 Molecule; C-Type Lectin Domain Family 4 Member L; DC-SIGN1; Dendritic Cell-Specific Intracellular Adhesion Molecules (ICAM)-3 Grabbing Non-Integrin; DC-SIGN; Dendritic Cell-Specific Inte

  • AA Sequence

    KVPSSLSQGQSKQDAIYQNLTQLKVAVSELSEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYEELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKQQEIYQELSRLKAAVGDLPEKSKQQEIYQKLTQLKAAVDGLPDRSKQQEIYQELIQLKAAVERLCRPCPWEWTFFQGNCYFMSNSQRNWHNSITACQEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNHEGTWQWVDGSPLLPSFKQYWNKGEPNNIGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSGDEERLLSPAPTTPNPPPE

  • Molecular Weight

    Approximately 44 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized Recombinant Rhesus Macaque DC-SIGN at 2 μg/mL canbind gp120. The ED50 for this effect is 1.092 μg/mL

  • DC-SIGN/CD209 Protein, Rhesus Macaque (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for DC-SIGN/CD209 Protein, Rhesus Macaque (HEK293, His)
  • Experimental Validation Results for DC-SIGN/CD209 Protein, Rhesus Macaque (HEK293, His)
  • DC-SIGN/CD209 Protein, Rhesus Macaque (HEK293, His) Product Image