DC-SIGN/CD209 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
DC-SIGN/CD209 Protein, a probable pathogen-recognition receptor, mediates the endocytosis and lysosomal degradation of pathogens. It recognizes high mannose N-linked oligosaccharides in pathogen antigens in a calcium-dependent manner and functions as a receptor for ICAM3, potentially through binding to mannose-like carbohydrates. DC-SIGN/CD209 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DC-SIGN/CD209 protein, expressed by HEK293 , with N-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
DC-SIGN/CD209 Protein, a probable pathogen-recognition receptor, mediates the endocytosis and lysosomal degradation of pathogens. It recognizes high mannose N-linked oligosaccharides in pathogen antigens in a calcium-dependent manner and functions as a receptor for ICAM3, potentially through binding to mannose-like carbohydrates. DC-SIGN/CD209 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DC-SIGN/CD209 protein, expressed by HEK293 , with N-His labeled tag.
Background
DC-SIGN/CD209 Protein is a probable pathogen-recognition receptor that functions in the endocytosis of pathogens, leading to their degradation in lysosomal compartments. It is capable of recognizing high mannose N-linked oligosaccharides in various pathogen antigens in a calcium-dependent manner. Additionally, it acts as a receptor for ICAM3, likely through its binding to mannose-like carbohydrates.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-His
-
Accession
Q8CJ91-1 (Q74-G325)
-
Gene ID69165 [NCBI]
-
Molecular Construction
-
N-term
-
His
-
CD209 (Q74-G325)
Accession # Q8CJ91-1 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD209; Dendritic Cell-Specific ICAM-3-Grabbing Non-Integrin 1; CD209 Molecule; C-Type Lectin Domain Family 4 Member L; DC-SIGN1; Dendritic Cell-Specific Intracellular Adhesion Molecules (ICAM)-3 Grabbing Non-Integrin; DC-SIGN; Dendritic Cell-Specific Inte
-
AA Sequence
QVSKTPNTERQKEQEKILQELTQLTDELTSRIPISQGKNESMQAKITEQLMQLKTELLSRIPIFQGQNESIQEKISEQLMQLKAELLSKISSFPVKDDSKQEKIYQQLVQMKTELFRLCRLCPWDWTFLLGNCYFFSKSQRNWNDAVTACKEVKAQLVIINSDEEQTFLQQTSKAKGPTWMGLSDLKKEATWLWVDGSTLSSRFQKYWNRGEPNNIGEEDCVEFAGDGWNDSKCELKKFWICKKSATPCTEG
-
Predicted Molecular Mass
31.4 kDa
-
Molecular Weight
Approximately 40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
