DC-SIGN/CD209 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The DC-SIGN/CD209 protein is expressed on immature dendritic cells (DC) and is an important pathogen recognition receptor that initiates primary immune responses. It mediates endocytosis and subsequent degradation of pathogens within the lysosomal compartment. DC-SIGN/CD209 Protein, Human (HEK293, His) is the recombinant human-derived DC-SIGN/CD209 protein, expressed by HEK293, with N-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The DC-SIGN/CD209 protein is expressed on immature dendritic cells (DC) and is an important pathogen recognition receptor that initiates primary immune responses. It mediates endocytosis and subsequent degradation of pathogens within the lysosomal compartment. DC-SIGN/CD209 Protein, Human (HEK293, His) is the recombinant human-derived DC-SIGN/CD209 protein, expressed by HEK293, with N-His labeled tag.
Background
DC-SIGN/CD209 Protein, expressed on the surface of immature dendritic cells (DCs), serves as a pivotal pathogen-recognition receptor, playing a crucial role in initiating the primary immune response. This receptor is implicated in the endocytosis of pathogens, leading to their subsequent degradation within lysosomal compartments. Following this process, DC-SIGN returns to the cell membrane surface, presenting pathogen-derived antigens to resting T-cells through MHC class II proteins, thereby triggering the adaptive immune response. On DCs, it acts as a high-affinity receptor for ICAM2 and ICAM3, binding to mannose-like carbohydrates. Notably, DC-SIGN may function as a DC rolling receptor, facilitating the transendothelial migration of DC precursors from the bloodstream to tissues by interacting with endothelial ICAM2. Furthermore, it appears to modulate DC-induced T-cell proliferation through its binding to ICAM3 on T-cells within the immunological synapse formed between DCs and T-cells.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2 S1 protein, Fc Tag at 5 μg/mL (100 μL/well) can bind Human CD209, His Tag with a linear range of 0.039-0.67 μg/mL.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-His
-
Accession
Q9NNX6-1 (Q59-A404)
-
Gene ID30835
-
Molecular Construction
-
N-term
-
His
-
CD209 (Q59-A404)
Accession # Q9NNX6-1 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD209; Dendritic Cell-Specific ICAM-3-Grabbing Non-Integrin 1; CD209 Molecule; C-Type Lectin Domain Family 4 Member L; DC-SIGN1; Dendritic Cell-Specific Intracellular Adhesion Molecules (ICAM)-3 Grabbing Non-Integrin; DC-SIGN; Dendritic Cell-Specific Inte
-
AA Sequence
QVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA
-
Predicted Molecular Mass
41.3 kDa
-
Molecular Weight
Approximately 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with 10% trehalose as protectant.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
