DC-SIGN/CD209 Protein, Human (HEK293, Fc)

The DC-SIGN/CD209 protein is expressed on immature dendritic cells (DC) and is an important pathogen recognition receptor that initiates primary immune responses. It mediates endocytosis and subsequent degradation of pathogens within the lysosomal compartment. DC-SIGN/CD209 Protein, Human (HEK293, Fc) is the recombinant human-derived DC-SIGN/CD209 protein, expressed by HEK293 , with N-hFc labeled tag.

DC-SIGN/CD209 Protein, expressed on the surface of immature dendritic cells (DCs), serves as a pivotal pathogen-recognition receptor, playing a crucial role in initiating the primary immune response. This receptor is implicated in the endocytosis of pathogens, leading to their subsequent degradation within lysosomal compartments. Following this process, DC-SIGN returns to the cell membrane surface, presenting pathogen-derived antigens to resting T-cells through MHC class II proteins, thereby triggering the adaptive immune response. On DCs, it acts as a high-affinity receptor for ICAM2 and ICAM3, binding to mannose-like carbohydrates. Notably, DC-SIGN may function as a DC rolling receptor, facilitating the transendothelial migration of DC precursors from the bloodstream to tissues by interacting with endothelial ICAM2. Furthermore, it appears to modulate DC-induced T-cell proliferation through its binding to ICAM3 on T-cells within the immunological synapse formed between DCs and T-cells.

Measured by its ability of the immobilized protein to support the adhesion of CHO Chinese hamster ovary cells transfected with ICAM-3. The ED₅₀ for this effect is 1.087 μg/mL, corresponding to a specific activity is 919.963 units/mg.

• 
  Measured by its ability of the immobilized protein to support the adhesion of CHO Chinese hamster ovary cells transfected with ICAM-3. The ED₅₀ for this effect is 1.087 μg/mL, corresponding to a specific activity is 919.963 units/mg.

Human

HEK293

N-hFc

Q9NNX6-1 (Q59-A404)

30835  [NCBI]

Extracellular Domain

QVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA

Approximately 78 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.